KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1897Help
Entry
SPUCDC_1897       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
  KO
K11893  type VI secretion system protein ImpJ
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Brite
KEGG Orthology (KO) [BR:sega00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sega02044]
    SPUCDC_1897
Secretion system [BR:sega02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUCDC_1897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: AGU64739
Position
1890427..1891758
Genome map
AA seq 443 aa AA seqDB search
MATTRNKVMWREGTLMRPHHLQQQQRYNDYVNNLRFRAIHDLSWGFTELSLNDELLGQGK
IMIDSASGTLPDGTVFSLPDQDALPDPLHPDSFPDEESRNVYLALPVASDVRGEVSYGQQ
VGRYRLSDASVRDLHSENGDARTLTLGQLTPRIMSGADDMSAYVTLPLCRIKDRRADGSL
MLDENFIPTCQNVYVSARLREFLREVQEAVGGRANDLANRIGSPAQSGIADVAEFMMLQL
LNRNQTRFTHRARRPHLHPEDFYLDLAGLLGELMTFTEPSRLPCPLDVYDHRNLTDTFKT
LLPEVKRALHTVLSPRAVNLPLHLRDGIWQADVHDSRLLQSATFVLAVAAKMETLQLQRQ
FIQQSKISSPEKIRNMVSVQIPGIPLHTLMVAPRQLPYHAGFSYFELDKSGAAWADVAAT
GAVALHVSGTFPDLNMQLWAIRG
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccacgcgaaacaaggtgatgtggcgggaaggaacgctgatgcgtccgcaccat
ctccagcagcaacaacgttataacgattatgtgaataatctgcgtttccgggccattcat
gatttgtcctggggatttaccgagctttccctcaatgatgagctgctgggacagggcaaa
attatgatcgacagcgcgtcgggcaccctgccggacggcaccgtgttttcccttccggac
caggatgcgctccccgatccgctgcatccggacagttttcctgatgaagaaagccgcaat
gtctatctggctttacccgttgccagcgatgtgagaggcgaagtcagttacgggcagcag
gttgggcgttaccggctgagcgatgccagtgtccgggatctgcactccgagaatggcgat
gcccggacgctgacgctgggccagttgaccccccgcattatgagcggagcggacgatatg
agcgcgtatgtcacgttgccgctgtgccgtatcaaagacaggcgtgcggacggctccctg
atgctggatgaaaactttatccctacctgccagaacgtttatgtcagcgcacggctgcgt
gaatttctccgggaagtccaggaagcggttggcggccgggccaatgacctggctaaccgc
attggctctccggcgcaaagcggtattgccgacgttgcggaatttatgatgctgcaactg
ctcaaccgtaaccagacgcggttcacccaccgcgcccgcaggccgcacctccatccggaa
gatttttatctcgatctggccggactgctgggcgagctgatgacatttaccgagccatcc
cgcctgccctgtccgctggatgtctacgatcaccgtaacctgacggacaccttcaaaacg
ctgttgccggaagtgaaacgggcattacataccgtcctgtcgcccagggcggttaacctg
ccgctgcatctgcgcgatggcatctggcaggctgacgtacatgactccaggctgttgcag
tcggccaccttcgtgctggcggtggcggcgaaaatggagacgctgcaactccagcgccag
tttatccagcagtcaaaaatttcctcgccggaaaaaatccgcaatatggtcagcgtgcaa
atccccggcatcccgctgcatacgctgatggtggcgccccgccagcttccgtaccatgcc
ggtttcagctatttcgaactggacaagagcggggccgcctgggcggatgtggcggccacc
ggcgctgtcgccctgcatgtttccggtacgttcccggatctgaacatgcaactgtgggcc
ataagaggataa

DBGET integrated database retrieval system