KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1902
Entry
SPUCDC_1902       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
sega03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sega00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SPUCDC_1902
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sega02044]
    SPUCDC_1902
Secretion system [BR:sega02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUCDC_1902
SSDB
Motif
Pfam: IcmF-related IcmF-related_N IcmF_C AAA_16 cobW AAA_22 AAA_29
Other DBs
NCBI-ProteinID: AGU64744
Position
1897343..1900804
AA seq 1153 aa
MPRFKVSAAWLLALAWILLLVWIWWKGPSWTLYEQRWLAPLANRWLATAAWGLIALTWLT
VRVMKRLQLLEKQQRQQRDEAQDPLSVELNTQQRYLDHWLLRLQRHLDSRRYLWQLPWYM
VTGPAGSGKTTLLREGYPSDIIYAPEALRGVEQRRYVIPHVGKQAVIFDADGLLFEQQDA
DILHRRLWTHMLDWLAQKRARQPLNGLILTLDLPDLLTADKPRREHLLQILRGRLQDIRQ
HLHCQLPVYVVLTRLDLLHGFAALFQSLDRNDRDAILGVTFTRHAHENDDWRTELNAFWQ
TWGEQLNNVLPERMLAPGSRSSLFSFVRQIQGGREPLIALLNGLLDGENMDVMLRGVYLT
SSLQRGQIDDIFMQSAARQFRLGSSPLTAWPLVDTLPYFTRNLFPQTLLAEPNLASESRV
WLMQSRRRLSVFSATGGIAALLLIIGWHHYYNNNWRSGITVLEQAKAFMSVPPPQGMDDY
GNLQLPLLNPVRDATLAYGDWGDRSRLADMGLYQGRRVGPYVEQTYLQLLEQRYLPALFN
GLVKEMNAAPAESEEKLAVLRVIRMLEDKSGRSDEVVKQYMAKRWSDKFHGQRDIQAQLM
SHLDYALKHTDWHAERQAGDGDAISRWTPYDNPVVAAQKELSKLPVYQRVYQSLKTRAMG
VLPADLNLRDQVGATFDQVFTSGDDNKLIVPQFLTRYGLQSYFVKQRDALIELTAMDSWV
LNLTRSVKYSDADRAEIQRQLTEQYLSDYTATWSAGMDNLNVRNYESIAQLTGALEQIIS
GDQPLQRALTALRDNTQPAVLSEKLDDKALQEAMAEPDYQLLTRLGHEFAPENSTLAVQK
DKENTLQAVYQQLTELHRYLLAIQNAPVPGKSALKAVQLRLDQNSSDPIFATRQMAKTLP
APLNRWVGKLADQAWHVVMVEAVHYMEVDWRDNVVKPFNEQLADNYPFNPRSQSDASLDA
FERFFKPNGVLDTFYQQNLRLFMENDLSLEDGDNNVIIREDVREQLDTAQEIREAFFSRQ
NGLGAQFAVETVSLSGNKRRSVLNLDGQLVDYSQGRNYTAHLVWPNNMREGNESKLTLIG
VSGGAPRSISFSGPWAQFRLFGAGQLTGVQEGTFSVRFNVDGGAMVYRVHTDTEDNPFTG
GLFSQFRLPDTLY
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgccccggtttaaggtttctgccgcctggctgctggcgctggcgtggattttgctgctg
gtatggatctggtggaaaggtccgtcatggacgctctacgagcagcgctggctggccccg
ctggcgaaccgctggctggccaccgccgcctgggggttgattgcgctgacgtggctgacc
gtccgggtcatgaagcgcctgcaactgctggaaaaacagcagcgccagcaacgggacgag
gcgcaggatccgctcagcgtggaactgaacacccagcaacgctatctcgatcactggtta
ctgcgtctgcaacgccatctcgacagccgccgctatctgtggcagctaccgtggtatatg
gtcactggcccggcgggaagcggtaaaaccacgctgctgcgcgaagggtatccgtccgac
attatttatgccccggaggcgctgcggggcgtggagcagcgccggtatgttatcccgcat
gtgggaaaacaggcggtgatttttgacgctgacggcctcctctttgagcaacaggatgcg
gatatactgcatcgccgcctgtggacccatatgctggactggctggcgcaaaaacgcgcc
cggcagccgctgaacggcctgatactgacgctggatctgcccgatcttctgaccgccgac
aagccacgccgtgagcacctgttgcagatcctgcgcggacgtttgcaggatatacgccag
catcttcactgccagctccccgtctatgtggtgctgacccggctggatctactgcacggt
ttcgccgccctgtttcagtcactggaccgcaacgatcgcgacgccattcttggcgtcacc
tttacccgtcatgcccatgaaaatgacgactggcgtacagaactgaatgccttctggcag
acatggggcgaacagttgaataacgtcctgccggagcggatgttagcccccggctcccgc
agttccctgttcagctttgtccgccagatccaggggggccgcgagccgctgatcgccctg
ctgaacgggctgctggacggggaaaatatggatgtgatgctgcgcggcgtgtacctcacc
tcctccctgcaacgcggccagatagacgatatttttatgcagtccgccgcccgtcagttc
cggctgggcagcagtccgctgaccgcctggccgctggtggacacgttaccgtatttcacc
cgtaatctgtttccgcagaccttactggctgagccgaacctcgccagtgaaagccgcgtc
tggctgatgcagtcccgccgccggttgtccgtgttttccgccactggcggcatcgccgcc
ctgctgctgattatcggctggcatcactattacaataacaactggcgttccggcatcacc
gtactggagcaggccaaagcttttatgtcggttccgccaccgcagggtatggacgattat
ggcaacctgcaactaccgttacttaacccggtgcgtgacgccacgctggcctacggcgac
tggggcgatcgcagtcgtctggccgatatgggattatatcagggcaggcgtgtcggccca
tatgtggagcagacctacctgcaactgctggagcagcgttacctgcccgccctgtttaac
ggcctggtcaaagagatgaatgccgcgcctgcggagagcgaggagaagctcgcggtattg
cgcgttatcagaatgctggaagataaaagcggacgcagcgacgaggtggtgaagcagtat
atggcgaaacgctggagcgataaatttcacggccagcgcgatattcaggcacagctaatg
tctcatctggactacgcgctgaaacacaccgactggcacgcggagcgtcaggcaggcgac
ggcgacgccatcagccgctggacgccgtatgacaatccggtcgtggcggcgcagaaagag
ctcagcaaactgcccgtctaccagcgcgtttaccagagtctgaaaacgcgggcgatgggc
gtgctgcccgctgatctgaacctgcgtgaccaggtgggcgccacgtttgatcaggtcttt
acctccggggatgataataagctcattgttccgcagttcctcacccgttacggtctgcaa
agttattttgtcaaacagcgcgacgcgctgatcgaactgacggcgatggattcctgggtg
ctgaacctgacccgcagcgtgaaatacagcgacgccgaccgggcggaaatccagcgccag
ctcactgaacagtatctcagcgactacaccgccacctggagcgccggaatggacaacctt
aacgtgcgcaattacgaatccattgcgcaactgaccggggcgctggagcagatcatcagc
ggcgatcagccgctccagcgggcgctgacggcactgcgcgacaacacgcagcctgccgtt
ctctctgaaaaactggatgacaaggcgcttcaggaggcgatggcggagccggattaccag
ttgctgacccgcctggggcacgaatttgccccggaaaacagcacgctggcggtacagaaa
gacaaagaaaacactctccaggcggtctatcagcaactgacggagctgcaccgttacctg
ctggctattcagaacgcgccggtgccgggaaaatcagcgctgaaagcggtgcagctacgg
ctggatcagaacagcagcgatcctattttcgccacccgccagatggcgaaaaccctgcct
gccccgctcaaccgctgggtgggcaagctggcggatcaggcctggcatgtggtgatggtg
gaggcagttcactatatggaagtggactggcgcgacaacgtggtcaaaccctttaatgaa
caacttgccgacaattatccgtttaacccacgctcacagtcagatgcgtcgctggatgcg
tttgaacgcttctttaaaccgaatggcgtactggataccttttatcagcagaacctgcgt
ctgtttatggaaaacgatctgagtctggaggacggggataacaacgtgattattcgtgag
gatgtccgggagcaactggataccgcacaggaaatccgcgaggcgtttttcagcagacag
aacggcctgggcgcgcagtttgccgtggaaactgtgtcgctttccggcaacaaacggcgc
agcgtgctgaatctggacgggcagttagtggactacagccagggccgcaattacaccgcc
catctggtctggccgaacaacatgcgtgaaggcaatgaaagtaagctgacgctgataggc
gtcagtggcggcgcgccgcgcagcatcagtttcagcgggccgtgggcgcagttcaggctg
ttcggcgccgggcaacttaccggcgttcaggaggggacattcagcgtgcgctttaacgtg
gacggcggagcgatggtgtaccgggtacataccgatacggaagataaccccttcaccggc
gggctgttcagtcagttccggctgccggataccctgtactga

DBGET integrated database retrieval system