KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_1904
Entry
SPUCDC_1904       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
  KO
K06887  uncharacterized protein
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Brite
KEGG Orthology (KO) [BR:sega00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPUCDC_1904
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGU64746
Position
1902197..1902676
AA seq 159 aa
MANLIYLTLNGEKQGLISAGCCSLDSIGNKAQLLHLDHIMVYELTHGLSRDQNVNHHSVT
IKKPVDKSSPLLGKAINDNEILTCTFDFYRTNRFGINEKYYKLELKNARISDINFSIAHV
VIDSEAQPQESISFIYESINWEHCIAGTSAFSLWDERVF
NT seq 480 nt   +upstreamnt  +downstreamnt
atggccaatttaatttatttaacactgaacggtgaaaagcaaggattgatttcagcaggt
tgttgttcccttgactctatcggtaataaagcacagttactgcaccttgatcatattatg
gtatatgaactgacacatgggttaagtcgggatcaaaatgtcaatcatcattcagttacg
ataaaaaaacctgtcgataaatcatctcctttactgggaaaagcaattaacgataatgaa
atattgacctgcacttttgatttttatcgaacaaatcgatttggtattaatgaaaaatat
tacaaactggaattaaaaaacgcccgaattagtgatattaatttctcgattgcgcatgta
gtcattgacagtgaagcacaacctcaggaaagtatttcttttatatatgaatccataaac
tgggaacactgtattgccgggaccagtgcattcagtttatgggatgagagggtgttttag

DBGET integrated database retrieval system