KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_2303Help
Entry
SPUCDC_2303       CDS       T02824                                 

Gene name
cobC
Definition
(GenBank) alpha-ribazole-5'-phosphate phosphatase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
sega00860  Porphyrin and chlorophyll metabolism
sega01100  Metabolic pathways
Module
sega_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:sega00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SPUCDC_2303 (cobC)
Enzymes [BR:sega01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     SPUCDC_2303 (cobC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AGU65128
Position
2319109..2319717
Genome map
AA seq 202 aa AA seqDB search
MRLWLVRHGETEANVAGLYSGHAPTPLTEKGIGQAKTLHTLLRHAPFDRVLCSELERARH
TARLVLEGRDVPQHILPELNEMYFGDWEMRHHRDLTHEDAESYAAWCTDWQNAVPTNGEG
FQAFTRRVERFISRLDAFSDCQNLLIVSHQGVLSLLIARLLAMPAASLWHFRVEQGCWSA
IDICEGFATLKVLNSRAVWRPE
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgtggctggtgcgtcatggcgaaaccgaggccaatgtcgccgggttgtatagc
ggacatgctcccacgccgttaacggaaaaagggattggccaggcgaaaacgctacatact
ttattgcgccacgcgccatttgaccgggtgttatgcagcgagctggagcgcgcgcgccat
accgcccggctcgtactggagggccgggatgtgccgcaacacatcttacctgagcttaat
gagatgtactttggcgactgggaaatgcgccatcaccgcgacctcacccatgaagatgcc
gaaagctatgccgcctggtgtacggactggcagaatgcggttccgaccaatggcgagggt
tttcaggcttttacccggcgcgtagagcgctttatctcgcgactcgacgcgtttagcgat
tgccagaacctgctgatcgtcagccatcagggcgtactcagcctgttgattgcccgtctg
ctcgcaatgcccgccgcctcgctatggcatttccgggtagaacagggatgctggagcgca
atcgacatatgcgaagggttcgccaccctgaaagtattaaatagtcgtgccgtctggcgg
cctgagtga

DBGET integrated database retrieval system