KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_3018Help
Entry
SPUCDC_3018       CDS       T02824                                 

Gene name
yqeF
Definition
(GenBank) putative acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
sega00280  Valine, leucine and isoleucine degradation
sega00310  Lysine degradation
sega00362  Benzoate degradation
sega00380  Tryptophan metabolism
sega00620  Pyruvate metabolism
sega00630  Glyoxylate and dicarboxylate metabolism
sega00640  Propanoate metabolism
sega00650  Butanoate metabolism
sega00900  Terpenoid backbone biosynthesis
sega01100  Metabolic pathways
sega01110  Biosynthesis of secondary metabolites
sega01120  Microbial metabolism in diverse environments
sega01130  Biosynthesis of antibiotics
sega01200  Carbon metabolism
sega01212  Fatty acid metabolism
sega02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sega00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPUCDC_3018 (yqeF)
   00630 Glyoxylate and dicarboxylate metabolism
    SPUCDC_3018 (yqeF)
   00640 Propanoate metabolism
    SPUCDC_3018 (yqeF)
   00650 Butanoate metabolism
    SPUCDC_3018 (yqeF)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPUCDC_3018 (yqeF)
   00072 Synthesis and degradation of ketone bodies
    SPUCDC_3018 (yqeF)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPUCDC_3018 (yqeF)
   00310 Lysine degradation
    SPUCDC_3018 (yqeF)
   00380 Tryptophan metabolism
    SPUCDC_3018 (yqeF)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SPUCDC_3018 (yqeF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPUCDC_3018 (yqeF)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPUCDC_3018 (yqeF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sega04147]
    SPUCDC_3018 (yqeF)
Enzymes [BR:sega01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SPUCDC_3018 (yqeF)
Exosome [BR:sega04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SPUCDC_3018 (yqeF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AGU65801
Position
complement(3037597..3038775)
Genome map
AA seq 392 aa AA seqDB search
MKEVVIVGALRTPIGCFQGTLARHSAVELGSMVVKALIERTGVDANAIDEVILGQVLTAG
AGQNPARQSAIKGGLPTTVSAITINDVCGSGFKALHLATQAIQCGEADIVIAGGQENMSR
APHVLNDSRTGALPDADNLVDSLVHDGLWDAFNDYHIGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDTGRFKDEIVPIVTQRNGQTAIVDTDEQPRADASAEGLALLHPAFDSLGS
VTAGNASSINDGAAAVMMMSEAKAQALGLPVLARIRAFASVGVDPALMGIAPVYATRRCL
ERAGWQLTEVDLIEANEAFAAQALSVGKMLEWDERRVNVNGGAIALGHPIGASGCRILVS
LVHEMVKRDARKGLATLCIGGGQGVALTIERD
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaggttgtgatagtgggggctttacggacacccatcggctgttttcagggaacg
ctggcccgtcattccgccgtcgagctggggagcatggtcgtaaaagcgttaattgagcgc
accggcgtggacgctaacgctatcgatgaggtcatcctcggtcaggtgctgacggctggc
gccgggcagaatccggcgcgccagtcagccatcaaaggagggctgccgactaccgtttcc
gccattactattaatgacgtttgtggttccggtttcaaagcgttgcacctggcgacgcag
gctattcagtgcggcgaagcggacattgttattgcgggcgggcaggagaatatgagccgt
gcgccgcatgtcctcaatgacagccgtaccggcgcgttgcctgatgccgacaatctggtg
gatagtctggtacatgatggcttatgggatgccttcaacgattatcacattggcgtgacg
gcagaaaacctggcgcgggaatatggcatcagccgcgagttacaggatgcttatgcgctc
agttcgcagcaaaaagccagggccgcgattgataccgggcgttttaaagatgagattgtc
cccatcgtcacgcaacgtaatgggcagaccgcaattgtcgatacggatgaacaaccgcgg
gccgacgccagtgcggaggggttagccctgctgcatccggcgtttgatagtttaggttcg
gtgacggcgggtaatgcctcctcaatcaacgatggcgccgccgcggtgatgatgatgagc
gaggcgaaagcccaggcgctggggctgccggtgctggcgcgcatccgcgcgtttgccagc
gtcggcgtcgatcctgcgctaatggggattgcgccggtatatgctacccggcgctgtctg
gagcgtgccggctggcaactgacggaggtcgaccttatcgaagccaacgaagcgtttgcc
gcccaggcgttgtcggtaggaaaaatgctggaatgggatgagcgacgggtaaacgttaat
ggcggcgcgattgcgctggggcatcccattggcgcttccggttgtcgaattctggtttca
ctggtgcacgaaatggttaaacgcgacgcgcgaaaaggtctggcgacgctgtgtatcggt
ggcggccagggcgttgctttaaccattgaacgcgactga

DBGET integrated database retrieval system