KEGG   Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67: SPUCDC_3122
Entry
SPUCDC_3122       CDS       T02824                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sega  Salmonella enterica subsp. enterica serovar Gallinarum/pullorum CDC1983-67
Pathway
sega03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sega00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SPUCDC_3122
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sega02044]
    SPUCDC_3122
Secretion system [BR:sega02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPUCDC_3122
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: AGU65903
Position
complement(3135040..3135525)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIKWQITAEKSDGAQQESRTSVWDLAMDQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgcgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
accgcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcaaatggcaaatcactgccgagaaatca
gacggcgctcagcaggagtccagaacgtcagtatgggatctggcgatggaccagataggg
aaatga

DBGET integrated database retrieval system