KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_A0084Help
Entry
SeHA_A0084        CDS       T00738                                 

Definition
(GenBank) integral membrane protein
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTH_54
Motif
Other DBs
NCBI-ProteinID: ACF65802
Position
pSL476_91:complement(49709..51877)
Genome map
AA seq 722 aa AA seqDB search
MKILLRALCAGLAISSLPAMASVTYQDIVSAATNPDDLSRQALVTIFGDVVTNPLSTSAP
TLIGSMFGAFNSIIAVLAVVWFMFIGIRHVVRSGHQGQVFSTGRDIVGTLSVVAGFLMIV
PTGNGWSIAQLIMLWGASIMGVGSANVMVQLAADNIANGYSMTVQPVQASTRTAARGIFE
MELCKYAVNAGLNDFNQTAKSSTSLMTESAKTASGNYTVTVSNGSGICGSASLSVEGNGT
TDQSTIGKFFNPFSKNEYSGVISAQRAAMDNMISDMDNAASEFVTTFLEKRNSGNGTLPD
IETRIQKVADEYERAVQKSLPTDNGEQSRKEALKSYLTTYGWVTLGAWYQTFATANQRLA
ELADRAPAVTSMSSLGEVGDTDLFSAVMSAYRTQLQNSSYTPPLGTVVSSSEQRMANAQD
PKSALSEIMGPLVSLTNRIATETSGTGTTSAQINPLIKMKNIGDITMVSAEGIWTIYTTA
RVVVAGGKDSILVKFFNSLTGAASMLTALFEALAPPVYFLLFLMFCAGFSLSIYLPFIPF
IFWMTGIGNWIVSVLIGCTAGPLWAATHLGTSEDRGSRAAYGYIYLIDSMIRPPIMVFGF
FFASVAIIAVGTILNALFGAALVNVQFNSLTGIFSLAGFLLIYARICTTTVAAIFALQAY
LPDHVINFLGGRDGANTLGSMANSVKEIFIGGSRNIRHTPGMKTDRLKDNTKGSDDKDGI
KG
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaattttacttcgcgcactctgtgcaggccttgctatatcctcactgccggcaatg
gcttcagtgacctatcaggatattgtgtctgccgccaccaatcctgacgatctgtcccgc
caggcgctggtcacgatattcggtgatgtagtcaccaatccactgtcaaccagcgccccc
actctgatcggaagcatgttcggggcgttcaacagtatcatcgccgtacttgccgttgtc
tggtttatgttcattggtatccgtcatgttgtgcgttcggggcatcagggacaggtattc
agcaccggacgcgatatcgtcggcacactgagtgtcgttgcaggttttctgatgatcgtt
ccaaccggaaatggctggagtatcgctcagctcattatgttatggggcgcatcgataatg
ggggttgggtccgccaatgtgatggtgcaacttgccgctgataatatcgcaaatggttat
tcaatgactgtacagccagttcaggcatccacacgaacagcagcgcgtggcatttttgaa
atggaactgtgtaagtatgcggttaacgcaggactaaatgattttaatcagacggccaaa
tcctcgacttcactgatgacagaatcagctaaaaccgccagtggtaattacactgtcacg
gtatccaatggcagcggtatctgtggttcagccagcctgtcagtagaaggaaacggaaca
acagatcaatcgacgattggaaaattctttaatcccttcagtaaaaacgaatacagcggt
gttatctcagcacaacgtgcagccatggataatatgattagcgacatggacaacgctgcc
agtgagtttgtgacaacatttctggaaaaaagaaattctggcaacggaacactgccggat
atcgagacacgaattcagaaagtagccgacgaatacgaacgtgctgtgcaaaaatcgcta
cccactgataacggagagcaatccagaaaagaggctcttaaatcttatctcacaacctac
gggtgggtaacgcttggcgcatggtatcagacctttgccactgctaaccagcgtctggca
gagctggctgacagagctccagctgtaacttcaatgtcatcactgggagaagttggtgat
actgacttattcagtgcggtcatgagtgcctataggacgcaactgcagaattcctcctat
acgccaccgctgggcacagtagtatcatccagtgaacaacgcatggcaaatgcacaagat
ccgaaatctgccttgtctgaaattatgggcccccttgttagtctcactaacaggattgca
acggaaacaagtggcacaggcacaaccagtgctcaaattaatcctctgataaaaatgaaa
aatatcggagatataacaatggtaagtgcagaaggaatctggactatatatacaacggcc
agagttgtcgttgccggtggcaaagattcaattcttgtaaaattctttaactcactaaca
ggtgccgcttcgatgcttaccgcgctgtttgaagcacttgcaccacctgtttattttctt
ttgttcctgatgttctgtgctggattttccttatcaatttacctgccattcattccgttt
attttctggatgacaggcatcgggaactggatagtcagcgtattaataggatgtaccgcc
gggccgctgtgggctgcaacacatctcgggacatcagaagacagaggaagtcgggcagcc
tacggttatatatacttaattgatagtatgataaggccgcccatcatggtctttggtttt
ttctttgcttctgtagccatcatcgccgtaggcacaatactgaatgcattatttggcgct
gccctggttaacgtacagttcaattcgctgaccggtattttcagtcttgctggtttcttg
ctgatatacgccagaatttgtacaaccactgtagctgccatatttgcccttcaggcctac
ctacctgatcatgttattaacttcctagggggacgtgatggagccaacacgcttggcagc
atggcaaattctgttaaagaaatatttattggaggaagtcgcaatatccgacatactcct
ggaatgaaaacagatcgtcttaaagataatacaaaaggaagtgacgacaaggacggaata
aaaggataa

DBGET integrated database retrieval system