KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C0311
Entry
SeHA_C0311        CDS       T00738                                 

Definition
(GenBank) type VI secretion protein, family
  KO
K11901  type VI secretion system protein ImpB
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Brite
KEGG Orthology (KO) [BR:seh00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seh02044]
    SeHA_C0311
Secretion system [BR:seh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeHA_C0311
SSDB
Motif
Pfam: T6SS_VipA DUF6103
Other DBs
NCBI-ProteinID: ACF69269
UniProt: A0A6C6ZQ36
Position
321700..322242
AA seq 180 aa
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDR
KFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALN
QLLEARTQLANLQTYMDGKAGAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
NT seq 543 nt   +upstreamnt  +downstreamnt
atggctatcaacaatagcgcgcagaaattcatcgcgcgcaaccgcgcgccgcgcgtgcag
attgaatatgacgtagagatttacggttccgagaaaaaaatcgagctgccgttcgtgatg
gcggtgctggccgatctggccgggaaaccgcgtgaagaactgccgccggtgacggatcgc
aaattcctcgatattgatattgataacttcaatgagcgcatgaaagccattgcgccgcgc
gtggcgttcgctgtgccgaatacgctgacgggtgaaggtcagttgatggtcgatatcacg
ctggaaaatatggacgacttttcgccggcacagattgcccgcaaggtggacgccctgaac
cagttactggaagcccgcacccaactggcgaacctccagacctacatggatggtaaggcc
ggggcggaaaatctggtcaataaactgttgcaggacccgaccctgctgaaaacgctggcg
aatgcgccgaaaccggccgctacccagcaaggtgtgtcagcggataatgaatcagcggaa
taa

DBGET integrated database retrieval system