KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C0323Help
Entry
SeHA_C0323        CDS       T00738                                 

Gene name
icmF
Definition
(GenBank) type VI secretion protein IcmF
  KO
K11891  type VI secretion system protein ImpL
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:seh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SeHA_C0323 (icmF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:seh02044]
    SeHA_C0323 (icmF)
Secretion system [BR:seh02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SeHA_C0323 (icmF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ImcF-related_N IcmF-related IcmF_C
Motif
Other DBs
NCBI-ProteinID: ACF68350
Position
331829..335698
Genome map
AA seq 1289 aa AA seqDB search
MQKFLSLLFSRRALAIVGVLVLALLVWFVGPLVSFDTLRPLASVGSRVVTIALLLMLLVL
WLVNWSMSIIGISVLCLAIGFVTPLLALGDVHPFAPLWVRLTLIGFILLMYALYGLYRLW
RALRMDEQLLRRFLHPRGEEVPVAGEIKADLRTVNHIVTQAIRQLRQLRVDMPGWRKIFE
GKRFLYELPWFMVVGSPGDGKTTALLNTGLQFPLAEQMEQTSRILTVPGGGTLHCDWWFT
NEAVLIDTAGRYARHDDGGEASAAQRNAGEWQGFLGLLRKHRPGAPLNGVILTLNVADLT
AQSPAERLAACAALRARLAELRETLGIRFPVYLVVTKMDLLPGFSEYFRTLTSHLRAQIW
GFTLPYSRRRKTGDPQALHAACAQELARLTLRLDQGLDTRLQEEYDLKSLQRLYTFPREF
AALGEPLLEAIEQIFLDSKFDATQLNNTLRGVFFTSAAQAQADAVADQLSIWQRFVRAIK
TARGESSASLPHALPDGNRSYFLHDLLTQFIFREAHLVEPNLQWAWRYRLLRLGGHLLVL
VLAFLLWQGMQTSQQTNGDYLNEISARATRLDGEVKAYTGKPAMAPVPTLLDSARELSAW
PELDPDAPPLTWRYGLYSVPPVTDSVASLYNRLLDQLLLPPLVKRMEYVLADAIARQDSK
AAYDALRIYLLLNLDKDHEDKYNAAEIQSWVINDLGNSDSVAGFGGRAAVLTHIEALFDG
SRVVHSPYEKNEALIRQARAFLDGHTSTERIYARALAAMESEAPQEFTLVRAVGADAGTV
FVRSNGAPLDRGVPGIFTREGYRELFDKRLPEFVAAATANDGWVMGRESTPKKLTDSLRS
QIPGQEQSVAREVRRLYLTEYARRWQDFLDSIHSINSAGEEGSSGLAYDLQVLRTLASPD
SPLMRLGKAVVEQTTLVPPPDPQARQKQLAQRASGNAGKVVQTAKLFQDIHPEERLEKTL
VDDRFAALREVIAGRTDGGQSGGGTMQIASLLTMLNEYYTQLTIADSALAAGTLPARITA
ADKLQLEAAKLPAPLKNILLDLTKQGTRKINAGTGDVLNTQMEAMMGDDCRDAIDGRYPF
ADSPQEVSAEDFNRIFASGGVLDAFWSKQLAPLADTASDPWRYKPTEGNMTLQGPDLTPF
QQAKQIRSVFFNSEGGKKFSWSMQISVVDMDPAITELVIDIDGQVLRYAHGPDRPLKVTW
PGPRNGSMAEITASPRIRQDTSTLLTGGPWALFHLLDAGMVQETAVRGRQLVEYDFDGRR
VVLEITAGRDFNPVSRELLQNFSCPARAL
NT seq 3870 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttcttagtctgcttttttcccggcgcgcgctggcgattgtgggcgttctg
gttctggcgctgctggtctggtttgtcgggccgctggtgtcatttgataccctgcgcccg
ctggcctccgtgggcagccgggtggtgaccattgccctgttgctgatgttgctggtactg
tggctggtcaactggtcgatgagtatcatcggcatcagtgtcctgtgcctggcgattggc
ttcgtcacaccgctgctggccctgggcgatgtccatccgtttgcgccgctgtgggtccgc
ctgaccctgattggtttcatcctgctgatgtacgcgctgtacggcctgtaccggctgtgg
cgtgcgctgcgtatggatgaacaactgctgcgtcgcttcctgcatccgcgcggggaagag
gtaccggtggctggcgagatcaaagccgacctgcgcaccgtcaaccatattgtcacgcag
gccatccggcaactgcggcagttgcgggtggacatgcccggctggcgtaaaatcttcgag
ggaaaacgctttctgtatgagctgccgtggttcatggtggtcggcagtcccggcgatggc
aaaaccacggccctgctgaacaccggattgcagttcccgctggcggagcaaatggagcag
acctcgcgtatcctgacagtgccgggtggcggcacgctacactgcgactggtggtttacc
aacgaagcagtgttgattgatacggccggacgctacgcccgccacgatgacggcggcgaa
gcgagcgccgcgcagcgtaacgccggagagtggcagggctttctcggtctgctgcgtaaa
catcgccccggcgcgccgcttaacggcgtgatcctgacgctaaacgtggcggatttaacc
gcacagtcaccggcggaacgcctggcggcctgcgcagctctgcgggcgcgactggcagaa
ctgcgcgagaccctggggattcgctttccggtctatctggtggtcaccaaaatggatttg
ttgccggggttcagcgagtattttcgcacgctgaccagccatcttcgcgcacaaatctgg
ggcttcacgttgccgtacagccgcaggcgaaaaacgggcgacccgcaggcgctgcatgcc
gcctgcgcgcaggagctggcgcgcctgacgctgcggctggatcagggactggatacccgg
ttacaggaagagtacgaccttaaaagcctccagcggctgtataccttcccgcgtgagttc
gccgccctcggcgagccgttgctggaggctattgaacagatcttcctcgattcaaaattc
gatgccacgcaactgaataacacgctgcgcggggtgtttttcaccagcgccgcgcaggcg
caggccgacgccgtggccgaccagttgagtatctggcagcgctttgtccgggcgataaaa
accgcccgtggcgaatcctccgcctctctcccacacgctctgccggacggcaaccgcagc
tactttctgcatgacctgctgacacagtttattttccgtgaagcgcacctggtggagcca
aacctccagtgggcctggcgttaccgcctgctgcgcctcggcgggcacctgctggtactg
gtgctggcattcctgttgtggcaggggatgcagaccagccagcagaccaacggcgactat
ctgaatgaaatcagcgcccgcgcgacccggctggacggcgaggtgaaagcctacaccggt
aaaccggcgatggctcccgtcccgacactgctggatagcgcaagggaactgtccgcctgg
ccggaactggacccggacgcgccgccgctgacctggcgctacggcctgtacagcgtaccg
ccggtaaccgacagcgtggcgtcgctgtacaaccgtctgctggatcaactgctgctgccg
ccgctggtgaaacggatggagtatgtgctggcggacgccattgcccgtcaggacagtaaa
gctgcgtatgatgccctgcgcatctatctgctactgaatctggataaagatcacgaagat
aaatacaacgcggcggagatccagtcgtgggtgattaacgatctggggaacagcgacagc
gtggccgggttcggcgggcgcgccgccgtgctgacgcatatcgaagcgctgtttgacggc
agccgggtggtgcattcaccgtatgagaaaaatgaggcactgatccgccaggcgcgggca
ttcctcgacggtcacaccagtaccgagcgtatctatgcgcgggcgctggcggcgatggag
agcgaagcgccgcaggagttcacgctggtacgcgccgtcggcgcggatgcgggaacggtg
tttgtgcgtagcaacggcgcgccgctggatcggggcgtgccgggtatttttacccgtgaa
ggataccgggagctgttcgacaaacgattaccggaatttgtggcggcggcgacggcgaac
gatggctgggtgatgggccgggagagtacgccaaaaaagctgactgacagcctgcgcagc
cagataccggggcaggagcagtctgtcgcccgcgaagtccgccgtttgtacctgacggaa
tatgcccgccgctggcaggattttctggacagtatccatagtatcaacagtgccggggaa
gagggcagttccggcctggcctatgatttacaggtgctgcgcaccctggcgtcgccggac
tcaccgctgatgcggctgggaaaagcggtggtggagcagaccacgctggtgccgccgccg
gacccgcaggccagacagaaacagctggcgcagcgcgcatccggtaacgcggggaaagtg
gtacagacggcaaaactgttccaggatattcacccggaagaacggctggaaaaaacgctg
gtggatgaccgtttcgccgcgctgcgcgaggtcattgccgggcggacggacggcggacag
agcggcggtgggacgatgcagatcgcttcgctgctgaccatgctcaacgagtattacacc
caactgaccattgctgatagcgcgctggcggcggggacgttgccagcgcgcattactgcc
gcagacaagttgcaactggaggcggcgaaactgcctgcgccgctgaaaaacatcctgctg
gatctgacgaagcagggaacgcgcaaaatcaacgccgggaccggcgacgtgctgaacacc
cagatggaggcgatgatgggcgacgactgccgtgacgccatcgacgggcgctatccgttc
gccgacagtccgcaggaggtcagcgccgaggactttaaccgcatcttcgccagcggcggc
gtactggatgctttctggagcaaacaactggctccgctggcggacaccgccagcgacccg
tggcgctacaaaccgaccgaaggcaacatgacgttgcaggggccggatttaacgccgttt
cagcaggcgaagcagatccgcagcgtattttttaacagcgagggcgggaaaaaattttcc
tggtcgatgcagattagcgtggtggatatggacccggccatcacggaactggtgattgat
atcgacggccaggtgctgcgctacgcccatggtccggaccgtcccctgaaagtaacgtgg
ccgggaccgcgcaacggctcgatggcggaaatcaccgccagcccgcgtattcgccaggac
acctcaacgctactgaccggcgggccgtgggcgctgtttcatctgctggacgccggaatg
gtacaggaaacggcggtgcgggggcgccaattggtggaatatgattttgacggtcgccgg
gtggtgctggaaatcactgccgggcgggattttaacccggtcagccgggagctgttgcag
aacttcagttgtccggcgagggcgttgtaa

DBGET integrated database retrieval system