KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C2389Help
Entry
SeHA_C2389        CDS       T00738                                 

Gene name
metG
Definition
(GenBank) methionyl tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00450  Selenocompound metabolism
seh00970  Aminoacyl-tRNA biosynthesis
seh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:seh00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    SeHA_C2389 (metG)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SeHA_C2389 (metG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:seh01007]
    SeHA_C2389 (metG)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:seh03016]
    SeHA_C2389 (metG)
Enzymes [BR:seh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     SeHA_C2389 (metG)
Amino acid related enzymes [BR:seh01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   SeHA_C2389 (metG)
Transfer RNA biogenesis [BR:seh03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SeHA_C2389 (metG)
 Prokaryotic type
   Other AARSs
    SeHA_C2389 (metG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ACF67264
UniProt: B4T9X0
Position
2297327..2299360
Genome map
AA seq 677 aa AA seqDB search
MTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEVNFICADDAHGTPIM
LKAQQLGITPEQMIGEMSQEHQTDFAGFNISYDNYHSTHSDENRELSELIYTRLKENGFI
KNRTISQLYDPEKGMFLPDRFVKGTCPKCKSADQYGDNCEVCGATYSPTELIEPKSVVSG
ATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFESGLQQWDISRDAPYFG
FEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKKDSDAELYHFIGKDIVY
FHSLFWPAMLEGSHFRKPTNLFVHGYVTVNGAKMSKSRGTFIKASTWLKHFDADSLRYYY
TAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFINKRFDGVLAAELADPQLYK
TFTDAAAVIGEAWESREFGKAIREIMALADIANRYVDEQAPWVVAKQEGRDADLQAICSM
GINLFRVLMTYLKPVLPTLSERVEAFLNSELNWDAIEQPLLGHKVNTFKALYNRIDMKQV
EALVEASKEEVKAAAAPVTGPLADFPIQETITFDDFAKIDLRVALIENAEFVDGSDKLLR
LTLDLGGEKRNVFSGIRSAYPDPQALIGRQTVMVANLAPRKMRFGVSEGMVMAAGPGGKD
IFLLSPDDGAKPGQQVK
NT seq 2034 nt NT seq  +upstreamnt  +downstreamnt
atgactcaagtcgcgaagaaaattctggtaacgtgcgcgctgccgtacgccaacggctct
atccacctcggccatatgctggagcacatccaggctgatgtctgggtccgttaccagcga
atgcgcggccatgaggttaacttcatctgtgccgatgacgctcatggcacgccgatcatg
ctgaaagcgcagcagcttggtattacgccggagcaaatgatcggtgaaatgagccaggag
caccagaccgatttcgccggttttaatattagctacgacaactaccactcaacgcacagc
gacgagaatcgcgagctgtccgagctgatttatacgcgcctgaaagagaacggttttatt
aagaaccgcactatctctcaactctacgatccggaaaaaggcatgttcctgccggaccga
tttgtgaaaggcacctgcccgaaatgtaaatccgcggaccagtacggcgataactgtgaa
gtctgcggcgcaacttacagcccgaccgaacttatcgagccgaaatccgtggtgtccggc
gcgacgccggtaatgcgtgactccgagcactttttctttgacctgccgtcattcagcgaa
atgttgcaggcgtggacccgcagcggcgcgctgcaggagcaggtggcgaacaaaatgcag
gagtggtttgaatccggcctgcaacagtgggacatttcccgcgacgcgccgtattttggt
ttcgaaatcccgaacgcgccgggcaaatatttctacgtctggctggacgcgccgattggc
tatatgggctccttcaaaaatctgtgcgataagcgcggtgacacgaccagttttgatgag
tactggaaaaaagactccgacgccgagctgtaccactttatcggcaaagacatcgtctat
ttccacagcctgttctggcctgccatgctggaaggcagccacttccgtaagccgaccaac
ctgttcgttcacggttacgtgacggtgaacggcgcgaagatgtctaagtctcgcggcacc
tttattaaggccagcacctggctgaaacactttgacgccgacagcctgcgctactactac
accgcgaagctttcttcacgcattgatgacatcgacctgaacctggaagactttgtccag
cgcgtcaatgccgatatcgtcaataaagtagtcaacctggcctcgcgtaacgccggtttt
atcaataagcgtttcgacggcgtgctggcggctgaactggccgatccgcaattgtataaa
acctttactgacgccgctgcggtgattggcgaagcatgggaaagccgtgaattcggtaaa
gctatccgtgagattatggcgctggccgacatcgctaaccgttatgttgacgagcaagcg
ccgtgggtggtggctaaacaagaaggccgcgacgcggacctgcaggccatttgctcaatg
ggcatcaacctgttccgcgtgctgatgacgtatctgaaaccggtactgccgacgctttct
gaacgcgttgaagccttcctgaacagtgagttgaactgggatgccatcgaacagccgctg
ctcggtcacaaggtcaacacctttaaggcgctctacaatcgcatcgacatgaagcaagtt
gaagcgctggttgaagcgtctaaagaagaggtgaaagccgcagctgcgccggttaccggc
ccgttagccgacttcccgattcaggaaaccatcacctttgacgatttcgccaaaattgac
ctgcgcgtagcattgattgaaaatgctgagttcgtagacggttctgacaaattgctgcgc
ctgacgctggatctgggcggcgagaagcgtaacgtcttctccggcattcgttccgcctac
ccggacccgcaggcgctgattggccgccagacggtaatggtcgccaacctcgcgccgcgc
aaaatgcgctttggcgtctccgagggaatggtgatggccgcaggacctggcgggaaagat
atcttcctgttaagccctgatgacggcgcgaagcctggccaacaggtgaaataa

DBGET integrated database retrieval system