KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C2661Help
Entry
SeHA_C2661        CDS       T00738                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00010  Glycolysis / Gluconeogenesis
seh00052  Galactose metabolism
seh00500  Starch and sucrose metabolism
seh00520  Amino sugar and nucleotide sugar metabolism
seh00521  Streptomycin biosynthesis
seh01100  Metabolic pathways
seh01110  Biosynthesis of secondary metabolites
seh01120  Microbial metabolism in diverse environments
seh01130  Biosynthesis of antibiotics
seh01200  Carbon metabolism
Module
seh_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
seh_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SeHA_C2661 (glk)
   00052 Galactose metabolism
    SeHA_C2661 (glk)
   00500 Starch and sucrose metabolism
    SeHA_C2661 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    SeHA_C2661 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SeHA_C2661 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SeHA_C2661 (glk)
Enzymes [BR:seh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SeHA_C2661 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: ACF65992
UniProt: B4TCD7
Position
complement(2575767..2576732)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDIASGEISQAKTYSGLDYPSLEAVVRVYLDEHSVSVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKKEHLIQFG
GGEPVDGKPIAVYGAGTGLGVAHLVHVDKRWISLPGEGGHVDFAPNSEEEAMILEILRAE
IGHVSAERVLSGPGLVNLYRAIVKSDNRLPENLRPKDITERALADNCIDCRRALSLFCVI
MGRFGGDLALTMGTYGGVYIAGGIVPRFLEFFKASGFRGGFEDKGRFKDYVHGIPVYLIV
HDNPGLLGSGAHLRQTLGHIL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggagatgtaggcggcacgaatgcgcgtcttgccctgtgt
gatatcgccagtggagaaatctcgcaggccaaaacgtattccggcctggattatcccagt
cttgaggccgtggtgcgcgtttatctcgatgagcatagcgtcagcgtggaagatggttgt
atcgccatagcctgtccgattaccggtgactgggtagcgatgactaaccatacctgggct
ttttctattgcggaaatgaaaaaaaatctcggctttagccatctggaaatcatcaacgat
ttcaccgccgtgtcgatggcgatcccgatgctgaaaaaagagcatttaattcagttcggc
ggcggcgaaccggtagacggcaaacctattgcggtgtatggcgcgggaaccggcttgggc
gtggcgcatctggtgcatgtggataagcgttggattagccttccgggcgaaggcgggcat
gtcgattttgcgcctaatagcgaagaagaagctatgattctggaaatattgcgcgccgaa
attggccacgtttccgccgagcgcgtgctgtctggcccggggctggtgaatctttaccgg
gcgattgttaagtccgacaaccgtctgccggagaatctgcgcccgaaagatattaccgaa
cgcgccctggcggataactgtatcgattgtcgccgcgcgttgtcgctcttttgcgtcatc
atggggcgatttggcggcgatctggcgttaaccatggggacatatggcggcgtttatatc
gctggcggtattgtcccgcgcttcctggaattttttaaagcgtctggcttccgtggtggc
tttgaagataaaggccgctttaaagattatgtacacggtattccggtctatctgattgtc
catgataaccctggcttgttaggctccggcgcgcatctgcgccagacattaggtcatatt
ctataa

DBGET integrated database retrieval system