KEGG   Salmonella enterica subsp. enterica serovar Heidelberg SL476: SeHA_C4863Help
Entry
SeHA_C4863        CDS       T00738                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase, catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
seh  Salmonella enterica subsp. enterica serovar Heidelberg SL476
Pathway
seh00240  Pyrimidine metabolism
seh00250  Alanine, aspartate and glutamate metabolism
seh01100  Metabolic pathways
Module
seh_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:seh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SeHA_C4863 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SeHA_C4863 (pyrB)
Enzymes [BR:seh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SeHA_C4863 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACF66674
UniProt: B4TG41
Position
complement(4734979..4735914)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GQVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHIAMVGDLKYGRTVHSLTQALAKF
SGNRFYFIAPDALAMPQYILDMLDEKGMAWSLHGSIEEVMADVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLNGARENMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSELSL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccgctatatcaaaaacatatcatttccataaacgacctcagccgcgacgat
cttaatctggtactggccacggcggcgaaattaaaagccaacccgcagccggagctattg
aaacataaagtgatcgccagctgctttttcgaagcctccacgcgtacccgcctgtcgttt
gaaacttcaatgcatcgcctgggcgccagcgtagtgggcttctccgacagcgccaacacg
tcgctggggaaaaaaggagaaacgttagccgacacgatctcagtgattagcacttacgtg
gacgcgattgtgatgcgccatccgcaagaaggcgcggcacgtctggcgacggagttttcc
ggtcaggtgccggtgctcaatgcgggcgacggttcgaatcagcatccgacgcaaaccctg
ttggatctgttcaccatccaggaaacgcagggccgtctggataacctgcatatcgcgatg
gtcggcgatctgaaatatggccgcaccgtgcattcgctaacccaggcgctggcgaaattt
agcggcaaccgtttttattttatcgcgccggacgcgctggcgatgccgcagtacattctg
gatatgcttgatgaaaaagggatggcctggagcctgcatggttctattgaagaggtcatg
gccgacgtcgacatcctctatatgactcgcgtacagaaagagcgtctcgacccgtcggag
tacgccaatgtgaaggcgcagtttgttctgcgcgccagcgacctgaacggcgcgcgtgaa
aatatgaaagtgctgcacccgctgccgcggattgatgaaatcaccacggatgtggataaa
acgccacacgcctggtacttccaacaggcgggcaacggtattttcgctcgccaggcgtta
ctggcgttagtactgaatagcgaactgagtctgtaa

DBGET integrated database retrieval system