KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00059Help
Entry
A35E_00059        CDS       T02336                                 

Definition
(GenBank) DNA helicase/exodeoxyribonuclease V, beta subunit
  KO
K03582  exodeoxyribonuclease V beta subunit [EC:3.1.11.5]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A35E_00059
Enzymes [BR:sehc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     A35E_00059
DNA repair and recombination proteins [BR:sehc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A35E_00059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UvrD-helicase UvrD_C AAA_19 UvrD_C_2 PDDEXK_1 DUF3860
Motif
Other DBs
NCBI-ProteinID: AFP85382
UniProt: J3TG88
Position
complement(116523..120074)
Genome map
AA seq 1183 aa AA seqDB search
MLLSNVKKLNPLTLCLRGSKLLEASAGTGKTYTLSVLYLRLLLGLGGEAAFPRLLRIEEI
LVVTFTETSTKELQYRIRNNIKQFRLACIRGKSEDVLFTELLEQIQDREHAALHLLEAER
QIDKAAIFTIHGFCQRVLNYSALELGVFFQYTLLDDEATLQQNMVFDFWRRHFYPLPLEV
ARIVHQQWEGPKKLLEDLQPYLRGELPKIFDPPELNESILSCHKRIIINIDHLKKYWREK
VVNIPDILNSYKLNRRIYNSKNLACWIKKINSWSVQPTVDYYIPEELERFTSTVLAKQTI
VGDPLNNAVFFSLEVFYQDRISLKKLIFVMALVKVRRDLEQEKKKRAELSFDDLLSYLDR
ALKGSEGKTLAQLIRSRYPVAMIDEFQDTDPQQYRIFHFTYCDKINSALLLIGDPKQAIY
AFRGADIFTYIRAKNEVDSCYSLSTNWRSSPGMVNAVNRLFQNIPDPFIFREIPFIEVSS
AKKNVCLKFIIKKHLQAALCIWLDSRDSVNIVEYQEYMANKCATTIRDFLCAASTGEAWL
ETNLGRKALQASDITILVRNSYEASLMQAALKKILISTVYLSNRDSVFDIPEALELLWIF
QAILKPEKDIILRTALATNLLSVDFSVIDALNQDQDLFEAIVEEFDGYHHYWKKNGVFPM
LRKIIINYRIGKNIDLNKGSTCRLADILHLGELLQEASLNIDNEHALVHWFALQIESSTT
HSPNQQLRLEADQDVIKIITVHKSKGLEFPVVFLPFAADFRIQNRAVFHDRENYLLWLDL
CSKEESLRLAEEERLAEDVRLLYVAVTRSIYHCSLGIAAICRGGGKKNRRSDLHLSALGY
LIQKGKSGNLDDLRKQLSLLVERGGGDIRICTSSTLCMEPFIPKMIVPEKSLNSCQWSKL
PSDNWRITSYTGLKQQIASVSIDLEQKVDFQFASKQEEVETLLPLTQHTFPRGIFFGKFL
HTLLEKITFNKPLDEKWLRLQLMEKNIDEIWCPVILDWMKTTINVPLDNSSLSLNRLKPE
NQYHELKFYLSVDATVNVNELDQIFKRYDSLSLICPPLDFPHFKGMLKGFIDLIFFWKGR
YYLLDYKSNWLGSESIFYNQFGIKQAMIAHRYEFQYQIYALALHRYLRHRIKQYHYSTHF
GGVYYLFLRGVDINNPGNGIFFCRPDKKLIYEFDKLCVGKYNN
NT seq 3552 nt NT seq  +upstreamnt  +downstreamnt
ttgttgttaagtaatgttaaaaagctcaatccattaacgttgtgtcttaggggaagcaaa
cttttagaagcttcagctggcacaggtaaaacttataccctatctgtgctttatctgcgt
ttattgctcggccttggaggtgaagctgcatttcctcgtcttttaagaattgaagaaata
ttagtggttacttttactgaaacttctactaaagaactacaatatcgcatccgtaataat
attaaacaattccgattagcttgtataagaggtaaaagtgaagatgtgttattcacagaa
ttattggagcagattcaagatcgagagcatgctgccttacatcttctagaagctgagaga
caaatagataaagctgcgatatttactattcatggtttttgtcaacgagtattaaattat
agtgcacttgaattgggtgttttttttcaatacactcttcttgatgatgaagcgacgctg
caacagaatatggtttttgatttttggcgtcgccacttctatcctctaccattagaagtg
gctcgaatagtacatcaacagtgggaagggccaaaaaaattactggaagatctacaacct
tatcttcggggagaattaccaaagatatttgatcctccagaattgaatgaatcaatttta
tcatgtcataaacgaatcattattaatattgatcatttgaaaaaatattggcgtgaaaaa
gtagtaaatattccagatattttaaatagttataaacttaatcggcgcatttataattct
aaaaatttagcatgttggataaaaaaaatcaattcttggtcagtgcaacctactgtcgat
tattatattcctgaggaacttgaacgttttacaagtacagttttagctaaacaaacaatt
gtaggtgatcctcttaacaatgctgtatttttttcgttagaggttttttatcaagataga
atatcgcttaaaaagttaatttttgtaatggcattagtaaaggttcgtcgagatcttgaa
caggaaaaaaaaaagcgagcagaattgagtttcgacgatttactaagttatttggataga
gctttaaagggaagtgaaggtaaaactctagctcagttaatacgttcacgctatccagta
gcaatgattgatgaatttcaggacacggatcctcaacaatatcgtattttccattttaca
tattgcgataaaattaattctgccttattgctaataggtgatcctaaacaagcgatctat
gcttttcggggtgcggatatctttacttacatccgagctaaaaatgaagtagattcttgt
tatagtctaagtactaattggcgatcttcgccaggaatggttaatgcagtaaatcgtctt
ttccagaatataccagatccgttcattttccgagagatcccttttattgaggtttcttca
gcaaaaaaaaatgtttgtttaaagtttattataaaaaaacacttacaggcagcgctatgt
atttggttagattcaagggattctgtaaatatagttgaatatcaagaatatatggcgaac
aagtgtgcgactactatacgtgattttctttgtgctgcaagcacgggagaagcatggtta
gaaactaatctgggaagaaaagcccttcaggcttcagatatcacaatacttgtgcgaaac
agttatgaagcatcattgatgcaggctgcattgaaaaaaatattgatttcaacagtctat
ctttcgaatagagatagtgtttttgatattccagaagcacttgaacttctatggattttt
caagcaatattaaaaccagaaaaagatattatactgcgcacagcgttagctaccaacctt
ctttctgtcgatttttctgttattgatgctcttaatcaagatcaagatctttttgaagca
atagtagaagaatttgatggatatcaccattactggaaaaaaaatggtgtttttccgatg
ttgcgtaaaattattatcaattaccgtatcggtaaaaacattgatttaaataaaggttct
acatgtcgattagccgatattttacatttaggggaattacttcaggaagcttcattaaat
attgataatgaacatgcgttagttcattggtttgcattacaaatagaatcttctaccaca
cactctccaaatcaacaattgagattagaagcagatcaggatgttataaaaattatcact
gtacataaatcgaaaggactggaatttccggtagtatttttaccgtttgcagcggatttt
cgaattcaaaatcgtgcagtatttcatgatcgagaaaattatttgctttggttagacctt
tgttcaaaagaagagagtctaagacttgctgaagaggaaagattagctgaagatgtgaga
ctattatacgtagcagtaacgagatctatttatcattgcagtctcgggattgcagcgata
tgtcgaggtggaggtaaaaaaaatagaagaagcgatttacatttaagcgctttaggttat
ttgattcagaaaggtaagagtggaaatcttgatgatttacgcaaacagttatcattatta
gtagagcgcggaggcggagatattagaatttgcacatcgagcactttatgtatggagcca
tttatacctaagatgatagttccagaaaagagtttaaattcttgtcagtggtctaaatta
ccgtctgataattggagaatcacaagctatactggactaaaacaacagattgcttcagtg
tcgattgatttagaacaaaaggtagattttcaatttgcctctaaacaagaagaagtggag
actttgttgccattgactcagcatacttttcctcgtggtatattttttggtaaattttta
cataccttacttgaaaaaattacttttaacaaaccattagatgaaaaatggcttcgttta
caattaatggaaaagaatattgatgagatttggtgtccggttatattagattggatgaaa
acaactatcaatgtaccactagataatagttcgctctctcttaatcgtttaaaacctgaa
aatcaatatcatgaactaaaattttatttatctgttgatgcaacagttaatgtaaacgag
ttagatcaaatttttaagcgttatgattctctatcgttaatctgcccgccgcttgatttt
cctcactttaaaggaatgctaaaagggtttattgatctaatttttttctggaaaggacga
tattacttattagattataaatctaattggttagggtcagagagcattttttataatcaa
tttggaataaaacaagcgatgattgctcatcgatatgaatttcaatatcaaatatatgcc
ttggcgttacatcgatatctgcgtcatcgtataaaacagtatcattattcaactcatttt
ggtggtgtgtattatctatttttacggggtgttgatataaacaatccgggaaatggtatt
tttttctgtcgtccagataaaaaattaatttatgagtttgacaagttgtgtgtcgggaaa
tataacaactaa

DBGET integrated database retrieval system