KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00063Help
Entry
A35E_00063        CDS       T02336                                 

Definition
(GenBank) thioredoxin
  KO
K03671  thioredoxin 1
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sehc03110]
    A35E_00063
Chaperones and folding catalysts [BR:sehc03110]
 Protein folding catalysts
  Protein disulfide isomerase
   A35E_00063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thioredoxin Thioredoxin_8 Thioredoxin_9 Thioredoxin_2 OST3_OST6 AhpC-TSA DIM1 Thioredoxin_6 Thioredoxin_7 Phage_int_SAM_4 Redoxin DUF836 Thioredoxin_3 KaiB TraF HyaE DUF953
Motif
Other DBs
NCBI-ProteinID: AFP85386
UniProt: J3VTS0
Position
129508..129852
Genome map
AA seq 114 aa AA seqDB search
MEKTENMSDKIICVTDTNFKINVLQSKRMVLVDFWAEWCGPCKTILPILSEIANEFDGKL
TIAKLNVSENPDTTTKYHIQSIPTLLLFHNNKVLDSKCGSISKKQIKEFVNQYL
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atggagaaaacagaaaatatgagtgataaaattatttgtgtaactgatactaactttaaa
ataaacgtattgcagtctaaaagaatggtgcttgttgatttttgggcagaatggtgtggt
ccttgtaaaacaattttaccaatcttatctgaaattgctaatgaatttgacggaaaatta
actattgcgaaattaaatgtcagtgaaaatccagacactacaacaaaatatcatatacaa
agtattccaactttattactgttccataacaataaagtattagatagtaagtgcggttct
atatctaaaaaacagataaaagaatttgttaatcaatatttataa

DBGET integrated database retrieval system