KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00068Help
Entry
A35E_00068        CDS       T02336                                 

Definition
(GenBank) ribosomal protein L33
  KO
K02913  large subunit ribosomal protein L33
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc03010  Ribosome
Module
sehc_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Translation
   03010 Ribosome
    A35E_00068
Ribosome [BR:sehc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    A35E_00068
  Bacteria
    A35E_00068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L33
Motif
Other DBs
NCBI-ProteinID: AFP85390
UniProt: J3TYG1
Position
complement(134946..135113)
Genome map
AA seq 55 aa AA seqDB search
MAKSIREKIKLVSSAGTGHFYTTTKNKRNKPEKIELRKFDPVVRKHIFYKEAKIK
NT seq 168 nt NT seq  +upstreamnt  +downstreamnt
atggctaagagtattcgcgaaaaaataaaactagtttcttctgctggaacaggacatttt
tatactaccactaaaaataaacgtaataaacctgaaaaaatagaactgcggaaatttgat
ccagtagtgcgtaagcatatattttacaaagaagctaaaattaaataa

DBGET integrated database retrieval system