KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00071Help
Entry
A35E_00071        CDS       T02336                                 

Definition
(GenBank) ribose-phosphate pyrophosphokinase
  KO
K00948  ribose-phosphate pyrophosphokinase [EC:2.7.6.1]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00030  Pentose phosphate pathway
sehc00230  Purine metabolism
sehc01100  Metabolic pathways
sehc01110  Biosynthesis of secondary metabolites
sehc01120  Microbial metabolism in diverse environments
sehc01130  Biosynthesis of antibiotics
sehc01200  Carbon metabolism
sehc01230  Biosynthesis of amino acids
Module
sehc_M00005  PRPP biosynthesis, ribose 5P => PRPP
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A35E_00071
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A35E_00071
Enzymes [BR:sehc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.1  ribose-phosphate diphosphokinase
     A35E_00071
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pribosyltran_N Pribosyl_synth Pribosyltran UPRTase PRTase_2
Motif
Other DBs
NCBI-ProteinID: AFP85393
UniProt: J3YSV2
Position
complement(145235..146182)
Genome map
AA seq 315 aa AA seqDB search
MTDMKLFSGNAIPDLAQHIANRLYTSLGNAAVSRFSDGEVSVQINENVRGGDLFIIQSTC
QPTNDNLMELVVMVDALRRASAGRITAVIPYFGYARQDRRVRSARVPITAKIVADFLSGV
GVDRVLTVDLHAEQIQGFFDVPVDNVFGSPILLEDMLQQNLENPIVVSPDIGGVVRARAI
AKLLNDTDMAIIDKRRPRANISQVMHIIGDVADRDCILVDDMIDTGSTLCKAAEALKERG
ARRVFAYATHPIFSGQACQNIRDSLIDEVIVCDTIPLSPAIKELSNVRTLTLSGMLAEAI
RRISNEESLSAMFEY
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
gtgactgacatgaagcttttttctggaaatgcgattccagatctagcgcaacatattgct
aatcgtttatatactagtctcgggaatgctgcagtgagtcgttttagtgatggcgaagtc
agcgtacaaattaatgaaaatgtgcgcggtggtgatctatttattattcaatctacgtgt
cagccgactaatgataatctaatggagttggtggttatggttgatgcactccggcgtgct
tctgccggtcgtatcactgcagtaattccttattttggttatgcacgacaagatcgtcgt
gtccgttctgctcgtgttccaattacagccaaaattgtagctgattttttatctggtgtt
ggtgtagatcgtgttttgacagtagacttgcacgctgagcagattcaaggtttttttgat
gttccagtggataatgtatttggtagcccaattctattggaagatatgctgcagcagaat
ttagaaaatcctattgttgtttctccagatattgggggcgttgttcgtgcaagagcaata
gcaaaattacttaacgatacggatatggcaattattgataaacgtcgtccgcgtgctaat
atatctcaagttatgcatattattggtgatgtggcggatcgggattgtattcttgttgat
gatatgattgatacaggcagtactttatgcaaagctgctgaagcgttaaaagagcgtggt
gctcgtcgtgtatttgcatatgcaacgcatccaattttttcgggacaagcgtgtcaaaat
attagagattcattgattgatgaagttattgtgtgtgacactattcctttgtcgccagct
attaaggaactttcaaacgtacgaactttgacactttctggtatgttagcagaggcgatt
cgccggattagtaatgaagagtctctttcagctatgtttgaatattaa

DBGET integrated database retrieval system