KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00076Help
Entry
A35E_00076        CDS       T02336                                 

Definition
(GenBank) NhaP-type Na+(K+)/H+ antiporter
  KO
K11105  cell volume regulation protein A
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
Transporters [BR:sehc02000]
 Other Transporters
  Electrochemical potential-driven transporters [TC:2]
   A35E_00076
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_C CorC_HlyC DUF3352
Motif
Other DBs
NCBI-ProteinID: AFP85398
UniProt: J3YSV5
Position
151839..153566
Genome map
AA seq 575 aa AA seqDB search
MDSSAIISLFIIGSILVGGSILLSAFSSRLGIPILLIFLAIGMLAGVDGVFGIAFDNYPI
AYLISNLALAVILLDGGMRTRTTAFRIALWPSLSLATIGIVVTAGLTGMAAAWLFGLNKI
EGMLIGAIVAPTDAAAVFSLLGNKGLNERVTSTLEIESGSNDPMAVFLTITLIAMIQHNR
HNLDWLFLLHLIREFGLGVIMGLGGGFILQQIINRITLTNALYPLLAVSGGIMIFALTTA
LKASGILAVYLCGFVLGNRPIHNRYGILQTFDGMAWLSQICMFLVLGLLVTPTDLWIIAI
PALILSLWLMFFARPLSIFIGLLPFRQYKNRERIFLSWVGLRGAVPIILAVFPMMAGLNN
SRLYFNLAFFIVLISLLLQGTSLGLAAKLAKVIVPPITLPFSRVGLDIHPENPWEQFIYQ
LKEKNKCIGLKINDLKMPPHTRIAALFRNNILLHPNDKTKLDEGDILCIIGRERDLPKLG
NLFSQSPSITLDQHALKNYVILEGSIRLHDVSSRYDGLKIPFKEQDNKLTLNEFVTKLLD
GKKPTVGDHGFSDGIMWKIIETKSNQISRIAIKII
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
ttggatagcagcgctattataagtttatttattataggttcgatattagtaggcggaagt
attcttcttagcgccttttcttcacgtcttggtattcccattctgttgatttttttagct
atcggtatgttagctggagttgatggtgtgtttggcattgcatttgataattatcctata
gcttatcttatcagtaacctagcgcttgcagtaattttgttagatggcggaatgcgtaca
cgtaccacggcttttcgtattgcgctgtggccatcactttctcttgcaacgattggtatc
gttgttactgctggtttaactggtatggctgctgcttggctattcggacttaataaaatt
gaaggaatgctgattggagcgattgtcgcccctaccgacgctgcagctgttttctcatta
ttaggtaataagggattaaacgagcgtgtaacttctactcttgagattgaatcaggaagt
aatgatcctatggcagtctttctaactattacattaattgccatgattcaacacaatcga
cataacttagattggctatttctattacatctaatccgcgaatttggtctcggagtgatt
atgggactaggaggtggttttattttgcaacaaatcataaatcgcataacgctaacgaat
gctttatatcctcttttagcagtaagtggaggaattatgatttttgccctaactaccgct
ctgaaagctagtggtattttagcagtttatctatgtggtttcgttttaggtaataggcct
atacacaatcgctacggtatcttacaaacatttgatggtatggcctggctcagtcaaatc
tgtatgtttctcgtcttagggttactagtaacccctactgatttatggatcattgctata
ccagctcttattttgtctctatggctaatgttttttgcacgccccctatcgatctttatt
ggtttgttaccatttcggcaatataaaaaccgagaacgtatttttctttcttgggttgga
ctacgtggagcagtaccaattatcttagcagtgtttcctatgatggcaggattaaataat
tctcgtctatattttaatctcgctttttttattgtacttatttctttattgttacaaggc
acctcacttggacttgctgctaaattagcaaaagttattgttccacccattacattacct
ttttctcgggtaggtttggatattcaccccgaaaacccctgggaacagtttatatatcaa
ctaaaagaaaaaaacaagtgtattggcttaaaaatcaacgatttaaaaatgcctcctcat
actcgaattgctgccttatttcggaataatatattacttcatcccaacgataaaactaaa
ttagacgaaggagatattctgtgtattatcgggcgggagcgagatttacctaaactaggt
aacttgtttagtcaatcaccatctatcacattagatcaacatgctctcaaaaattatgtt
atactagaaggtagtatacgtttacatgatgtttcatcccgatatgatggtctaaaaata
ccttttaaagaacaagataataagttaactcttaacgaatttgtaacaaaattgctcgat
ggaaaaaaacccacagtcggcgaccatgggttttcagacggaattatgtggaagattata
gaaacgaagtcaaatcaaattagtagaatcgccataaagattatttga

DBGET integrated database retrieval system