KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00079Help
Entry
A35E_00079        CDS       T02336                                 

Definition
(GenBank) amino acid/peptide transporter (peptide:H symporter)
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    A35E_00079
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-ProteinID: AFP85401
UniProt: J3VTS7
Position
complement(157140..158624)
Genome map
AA seq 494 aa AA seqDB search
MLTVNEQSTASRVTVNAFKQPKAFYLIFSIELWERFGYYGLQGILAVYLVKMLGLSETDS
ITLFSSFSALVYGFVAIGGWLGDKVLGTKRVIILGALVLTVGYSMVACSNHQIFWVYLGM
ATIAVGSGLFKANPSSLLATCYEKNDPRLDGAFTMYYMAINIGSFFSMLAAPWLASNYGW
CVAFSLSVVGMLITLINFIFFRGCVKNYGSPPDFMSIKWFQLLGVIIGVIALIPCASFLL
HHQEIARLVLGIVTVGVLIVFFYETLCLANVERRRMLVALMMMLEAVVFFVLYSQMPTSL
NFFAIHNVKTSLLGLDFEPEQLQALNPFWIMLASPLLAAWYNRLGDKLPMTFKFAIGMIL
SSLAFLLLPLGAIFANERGIVSPYWLIFSYALQSIGELMISGLGLAMVAQLVPQRLMGFI
MGTWFLTTAAAAIIAGFVANLSAIPLNVIEPHHSLKLYSDVFLQIGLVTGLIALLMLLFA
PKLNRLSLHVYEEK
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactgtaaatgaacaatctaccgcctcgcgcgtaacggtaaatgcttttaaacaa
ccaaaagcgttttatctaattttttctattgagttgtgggaacgttttggctattacggc
ctgcaaggtatattagctgtttatttagtaaaaatgttaggattatctgaaactgattct
attacccttttttcttcttttagtgctctggtatatggttttgttgccatcggtggttgg
ttgggtgataaagtgttaggtactaaacgcgttattatcttaggtgctttagttcttaca
gtcggttatagcatggtagcttgttcaaaccatcagatattttgggtttatcttggtatg
gccacgattgctgttggaagtggactgtttaaagctaatccttcttctttattggctaca
tgttatgaaaaaaatgatccccgcttagatggggcttttactatgtattatatggcaatt
aacatcggatcttttttttcaatgcttgcggctccatggctagctagtaattatgggtgg
tgtgtagctttttcattaagtgttgttggcatgcttattacattaataaattttatattt
tttcgtggttgtgttaagaattatggatcacctccagactttatgtctatcaaatggttc
cagttgttaggggttataattggtgtgattgcacttatcccctgcgctagttttttattg
catcaccaagagatagcgcgtttagtccttggaatagtgacagtaggagtgttaatagtt
tttttctacgaaacgttgtgtttagcaaatgtagaaagacgtcgtatgttagtagcacta
atgatgatgttagaagctgtagttttctttgttctttatagccaaatgcccacttcctta
aacttttttgcgatccataacgtaaaaacatctttattgggattagattttgaacctgaa
cagcttcaagctctaaatcctttctggattatgcttgccagtcctttgttggcggcgtgg
tataaccgtcttggtgataagcttccaatgacatttaagtttgctattggtatgatactt
tcttcattagcgtttcttttgctacccctaggtgctatatttgctaatgaaaggggtata
gtttcaccttattggttgatttttagctatgctttacaaagtattggggagttaatgatc
tcaggtcttggtttagctatggttgctcagttagttcctcaacgtttaatggggtttatt
atgggtacttggttcttgacaactgcggcagcagcgataattgctggatttgttgctaat
ctgtcggcgattccattaaatgtaattgagcctcatcattctttaaagttatatagcgat
gtatttcttcaaataggtcttgttactgggttgattgctttgctaatgcttctatttgcg
ccgaaacttaatcgtttatctttacatgtttatgaagaaaaataa

DBGET integrated database retrieval system