KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00081Help
Entry
A35E_00081        CDS       T02336                                 

Definition
(GenBank) Rhodanese-related sulfurtransferase
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rhodanese
Motif
Other DBs
NCBI-ProteinID: AFP85403
UniProt: J3YSV8
Position
162722..163159
Genome map
AA seq 145 aa AA seqDB search
MQKFIQFFIKHFILSLSWIFIFCTLIFVVFQNYFSKLKKITRIEAIQLINKEDAVIIDLR
DYYDYQKGHIVNSLNLSQLDLKCQNLQTLGKEKHKPIIVVCNTGNESYSSAKTLITAGFN
RVYVLTEGIYGWKKENLPLVSSKST
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaatttattcaattttttataaaacatttcatacttagcctctcctggatattt
attttttgcacgcttattttcgttgtttttcaaaactacttttctaagttaaaaaaaata
acccgtattgaagctatccaattgattaataaagaagatgcagtaattattgatttgagg
gactattatgattaccaaaaaggacatatcgttaatagcttaaatttaagtcagctagat
cttaagtgtcagaatttacaaacattagggaaagaaaaacataagcccattattgttgtc
tgcaataccggaaatgagtcttattcctcagcaaaaactctaatcacagctggattcaat
cgagtttatgttcttacagaagggatttacggatggaaaaaagaaaatttacccctagta
agttctaaatcaacctga

DBGET integrated database retrieval system