KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00087Help
Entry
A35E_00087        CDS       T02336                                 

Definition
(GenBank) arginyl-tRNA synthetase
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00970  Aminoacyl-tRNA biosynthesis
Module
sehc_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    A35E_00087
Enzymes [BR:sehc01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     A35E_00087
Amino acid related enzymes [BR:sehc01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   A35E_00087
Transfer RNA biogenesis [BR:sehc03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A35E_00087
 Prokaryotic Type
   Other AARSs
    A35E_00087
Mitochondrial biogenesis [BR:sehc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    A35E_00087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 Arg_tRNA_synt_N tRNA-synt_1e Ribosomal_L20 Clathrin
Motif
Other DBs
NCBI-ProteinID: AFP85409
UniProt: J3Z540
Position
170062..171792
Genome map
AA seq 576 aa AA seqDB search
MNIQNLLSNKIYQALLTAGANPDCEPQVCQTSNPQFGDYQANGIMEIAKNIGLQPRFLAE
RVVNLLQLNDIAYKVDIVDPGFINIFLQSSWLEKHLFAALSCPRLGIKAVLPKTIVVDYS
SPNVAKEMHVGHLRSTIIGDASVRTLSFLGHTVIRANHIGDWGTQFGMLIAYLEKVQYTN
ETTINLSKLENFYRAAKQHYDEDLEFAKRARSYTVQLQKGNEYCRQLWRKLVDITISQNQ
KIYERLNVTLTREDIMGESLYSTMLSDIVEDLKEKGMAVVNKGASIIFLNEFKNKEGNPM
GVIIQKKDGAYLYTTTDIACAKYRYETLQANRVIYYVDSRQHQHLVQAWTIARKAGYIPE
SVSFEHHMFGMILGKDKKPFKTRAGNTIKLVDLLDEALERARRVVLAKHPAIDTKELETL
AKIIGIGALKYADLSKNRNTDYVFNWDNMLTFEGNTAPYIQYAYARIISIFKRIKEDNQN
LNKQFFLKTTSEHQLAVHLLKLEETITIIASRGTPHVLCSYLYDLAVLFSTFYEKCPILK
TADAALRESRLQLAILTARTIKQGLDLLGIQTVERM
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacagaatcttctttcaaataaaatctatcaagctcttctcaccgctggcgca
aaccccgattgtgaaccacaagtttgtcaaacatcgaatcctcaatttggcgattatcaa
gctaatggaattatggagatcgccaaaaatattggtttacaaccccgctttctagcagaa
agagtcgttaatttattacaattaaatgatatcgcctataaagttgatattgtagatcct
ggttttattaatatttttcttcaatcaagttggctagaaaaacacctttttgcagctcta
tcctgtccgcgacttggcattaaagctgttttaccaaaaactattgtagtggattattct
tcacctaacgttgctaaagaaatgcatgttggtcatctgcgttcaactattatcggtgat
gcctcagttcgtactttatcttttttgggtcatacggttattcgagctaatcatataggt
gattggggaacgcagttcggaatgctaatcgcttacttagaaaaagttcagtatactaat
gaaacaacaataaatctttcaaaattagaaaatttctatcgtgctgctaagcagcattac
gacgaggatctagaatttgctaaacgcgcgcgcagctatacagttcaactccaaaaaggt
aacgaatattgccgacaactttggaggaaattagtcgatataactatatcacaaaatcaa
aaaatctacgaacgcctgaatgtcacattaacacgcgaagatattatgggagaaagtctt
tatagcacaatgctgtcagatattgttgaagacttaaaagaaaaagggatggctgtcgtc
aacaagggagcctccattatttttctaaatgaatttaaaaataaagaaggtaaccccatg
ggggtaattattcaaaaaaaagatggcgcttatctgtataccaccaccgatatcgcttgc
gcgaaatatcgttatgaaacattacaagctaatcgggtaatctattacgttgattccaga
caacaccaacatctggttcaagcctggactattgcgcgaaaagcgggctatatccctgaa
tcggtatcgtttgaacaccatatgtttggtatgatactaggaaaagataaaaaacctttt
aaaactcgagcaggaaacaccattaagttagtcgatctactagatgaagcgctagaacgt
gcccgtcgtgtggtattggctaaacaccctgcaatagatactaaagagttagaaacttta
gctaaaataataggaattggtgcgcttaaatatgcagatttatcgaaaaatagaaatact
gattatgttttcaactgggacaacatgcttacctttgagggtaatacagctccctatata
caatatgcctacgctcgtattatctcaatatttaaacgcattaaggaagacaatcaaaat
cttaataaacaattttttttaaaaacaacctcagaacatcaactggcagttcatttatta
aagttagaagaaacgattactattattgcatctcgcggaacaccacatgttctttgttct
tatctatatgatttagctgtattgttctctactttttacgaaaaatgtccgatcctgaaa
actgcagatgcagctttacgtgaaagtcgactacaattagccatacttactgcgcgcaca
ataaaacaaggcctggatttactaggaatccaaaccgtagagcgaatgtaa

DBGET integrated database retrieval system