KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00097Help
Entry
A35E_00097        CDS       T02336                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00010  Glycolysis / Gluconeogenesis
sehc00051  Fructose and mannose metabolism
sehc00562  Inositol phosphate metabolism
sehc01100  Metabolic pathways
sehc01110  Biosynthesis of secondary metabolites
sehc01120  Microbial metabolism in diverse environments
sehc01130  Biosynthesis of antibiotics
sehc01200  Carbon metabolism
sehc01230  Biosynthesis of amino acids
Module
sehc_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A35E_00097
   00051 Fructose and mannose metabolism
    A35E_00097
   00562 Inositol phosphate metabolism
    A35E_00097
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:sehc04147]
    A35E_00097
Enzymes [BR:sehc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     A35E_00097
Exosome [BR:sehc04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   A35E_00097
  Exosomal proteins of bladder cancer cells
   A35E_00097
  Exosomal proteins of melanoma cells
   A35E_00097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: AFP85414
UniProt: J3Z543
Position
187862..188626
Genome map
AA seq 254 aa AA seqDB search
MRNYLIIGNWKLNGTKEIINNRALMLRSKINNTINCDVAVAPPLPYLHLTQHYLKDTNIA
LCAQNIDIHTSGAYTGDISPKMLKDIGAKYSIIGHSERRLYHKENNELIAEKFAVLKKSG
LIPVLCIGESEEERRSGQTQKICINQIDAIINKVGITAFQNSVIAYEPIWAIGTGKAALP
SQAQKIHEFIRSYINEYDSESAKQVIIQYGGSVNIDNAAALFNQPDVDGALIGSASLNPD
IFSILVKIALERKK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaactatttaataatcggtaattggaagcttaatggtactaaagaaataatcaat
aatcgcgcactcatgttacgcagtaaaataaataacactattaattgtgatgtagcagtt
gcaccaccactcccttatcttcaccttacacagcactatctgaaagataccaacattgcg
ctatgtgcgcaaaacatcgacatccacacctccggggcttatactggtgatatctcccct
aaaatgcttaaagatattggcgctaaatatagtatcattggtcactctgaacgccgtctt
tatcataaagaaaataatgaacttattgccgaaaaatttgcggtattaaaaaaaagtggt
ttaattccagtattatgtataggtgaaagtgaagaggaaagaagatcgggacaaactcaa
aaaatttgtattaatcaaattgatgcaataatcaataaagttggtatcacagcatttcaa
aattctgttattgcctatgagcctatttgggctattggaactggtaaagctgcactacca
agtcaagctcaaaaaatccatgaatttattcgtagttatattaatgaatatgattcagaa
agtgcaaaacaagttattattcaatatggaggatcagtaaacattgacaatgctgctgca
ctctttaatcagccagatgtcgatggtgctctcattggttccgcatcactaaatcctgat
attttttcaatactagttaaaattgctttagaaagaaaaaaataa

DBGET integrated database retrieval system