KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00107Help
Entry
A35E_00107        CDS       T02336                                 

Definition
(GenBank) rod shape-determining protein MreD
  KO
K03571  rod shape-determining protein MreD
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sehc03036]
    A35E_00107
Chromosome and associated proteins [BR:sehc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Other chromosome partitioning proteins
    A35E_00107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MreD Voltage_CLC DUF2070
Motif
Other DBs
NCBI-ProteinID: AFP85423
UniProt: J3YSW9
Position
complement(207301..207789)
Genome map
AA seq 162 aa AA seqDB search
MNEYHRDSGWTIWFSFLVGMILQIIPWPFQICFFLPFWTKLLLIYWITVLPHRVNINAAF
ILGLITDIIFGITIGIHALAFTILSYLALLKFHLFRNLTLWQQSLLVLMFSLITDIIIFW
AQFLIMNVEFSSETFWNSVIDGIWWSWIFLTMQKIRRKLSMK
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtatcaccgtgatagcggctggactatttggttttcattccttgtagggatg
attttacaaattattccttggccttttcaaatatgcttcttccttcctttttggacaaag
ttgttgcttatttattggattacggttttgcctcatagagtcaacattaatgcggcattt
attcttggcttgataacagatataatatttggtattacaataggaatacacgcattggcg
tttactattctttcctatttagcattattaaaatttcacttatttcgaaacctaactctt
tggcaacaatcacttttagtattaatgttttcattaataacagatataatcatattttgg
gcgcaatttttaataatgaatgttgaattttcttcggaaacattttggaatagtgtaata
gatggcatatggtggtcgtggatatttttaacaatgcagaaaatacggcgtaaattaagc
atgaaatga

DBGET integrated database retrieval system