KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00110Help
Entry
A35E_00110        CDS       T02336                                 

Definition
(GenBank) regulatory inactivation of DnaA Hda protein
  KO
K10763  DnaA-homolog protein
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
DNA replication proteins [BR:sehc03032]
 Prokaryotic Type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    A35E_00110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_DnaA
Motif
Other DBs
NCBI-ProteinID: AFP85426
UniProt: J3VTT9
Position
211473..212174
Genome map
AA seq 233 aa AA seqDB search
MNTPMQLSLPLYLPDHKTFSSFYPGNNDVLLSALQDILGDKHGSYLYFWSCKGGGRTHLL
HAACSKLSSQDKAVGYVPLDKRTWLVPEVLEGMEQLALVTIDNIEYIAGDLPWEIAIFNL
YNRIQETGYTRFIISGNCPPRQLNLHLPDLASRLDWGQIYRLNPLSDEGKGYALQMRAKL
RGFELTEDVSCFLLKRLQRDMRTLSVALEQLDHASICAKRKLTIPFVKSILNL
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
ttgaacacaccgatgcagctttctttaccactctacttacctgaccacaaaactttttcc
agcttttatcccggcaataatgatgtattattgtccgcactgcaagatatacttggcgat
aaacacgggagctatctttatttttggtcatgtaaaggaggtggacgaactcatttacta
catgctgcatgttcaaaactttcttctcaagataaagccgtcgggtatgtacctctggat
aaacgcacttggcttgtcccggaagtattggaaggcatggagcaactagctcttgtcact
attgacaatatagaatatatcgctggagatttaccatgggaaatagccatttttaatctc
tataatcgaattcaagaaactggttatacaagatttattattagcggtaactgccctcct
cgacaattaaatctacacttaccagatttagcatctcgtttagattggggacaaatttac
cgtctgaaccctttatccgatgaaggtaagggatatgcgttacaaatgcgagcaaaatta
cgcggatttgagttaacagaagatgttagttgttttctgttaaagagattgcaaagagat
atgcgaaccttatcggtagcgctagaacaacttgaccatgcttctatttgcgctaaacgc
aagttaactattccatttgtgaaaagtatactgaatctttaa

DBGET integrated database retrieval system