KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00113Help
Entry
A35E_00113        CDS       T02336                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00030  Pentose phosphate pathway
sehc01100  Metabolic pathways
sehc01110  Biosynthesis of secondary metabolites
sehc01120  Microbial metabolism in diverse environments
sehc01130  Biosynthesis of antibiotics
sehc01200  Carbon metabolism
sehc01230  Biosynthesis of amino acids
Module
sehc_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
sehc_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A35E_00113
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    A35E_00113
Enzymes [BR:sehc01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     A35E_00113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N DUF498
Motif
Other DBs
NCBI-ProteinID: AFP85429
UniProt: J3Z551
Position
216826..218826
Genome map
AA seq 666 aa AA seqDB search
MLSKQILANTIRVLSMDAVEKANSGHPGAPMGMADIAEVLWRNYMNHNPSNPTWVNRDRF
VLSNGHGSMLLYSLLHLTGYNLSIEDLKKFRQLYSKTPGHPEYGYTPGVETTTGPLGQGL
ANAVGFAISERTLAAQFNREGHEIINHNTYVFLGDGCMMEGISHEACSLAGTMKLGKLTA
FYDDNGISIDGNIKGWFNDNTATRFESYGWHVIRDVNGHDSHSIKEAIEQTLLFPDKPSL
LICKTIIAFGAPTKAGTCLAHGAPLGKDEITATRKALGWNDEPFIITDEIYQHWDATEAG
EKKEKIWNDRFSAYEKDFPKMASEFKRRIKNELPLNWKMEIQGIIKRFQDQPQNIATRKA
SQNTLNSFCTILPELIGGSADLSPSNLTISSRSTSISDNKDGNYIHYGVREFAMTAIANG
IAHYGGFLPYTATFLMFVDYARNAVRMAALMKTRHIMIYTHDSIGLGEDGPTHQPIEQLA
SLRLIPNISVWRPCDQVETAVSWKNAIEKTNGPTALILSRQNLKQQDRTEEQLENITKGG
YVLKDCFGNKPELILIATGSEVELAVKAHKQLQTEGYKIRVVSMPSTDIFDAQDATYREL
VLPKAVKFRIAIEAGIADFWHKYVGFDGKIIGMNSFGESAPAEKLFEIFGFTIENIIKQA
RLLLNK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgctatcaaaacaaatattagctaatactattcgtgtgttaagtatggatgctgtagaa
aaagctaattctggtcatccaggcgcgccaatgggcatggcggatattgcggaagttctt
tggcgaaattatatgaatcataatccatctaatccaacatgggttaatcgagatcgcttt
gtactctccaatggtcacggatccatgctgctatacagcttgttacatcttactggatat
aatctgtcaatagaagacttaaaaaaatttcgtcagttatattctaaaacaccgggacat
cctgagtatggttatacccctggagtagaaaccaccacaggccctttgggacaaggactt
gctaatgcagtggggttcgctattagtgagcggacactagctgcacaatttaaccgtgaa
ggtcatgagattattaatcacaacacctatgtttttcttggtgatggctgcatgatggaa
ggcatttcgcatgaagcttgttctctcgcagggacaatgaagttaggaaaattaacagcc
ttctatgacgataatggtatctctattgacggtaacataaaaggttggtttaatgataat
actgctacgcgctttgaatcttatggctggcatgttatacgcgatgtaaatggtcatgat
agtcattctattaaagaagccattgagcaaacactcttatttcctgataaaccatcccta
ttaatatgtaaaacaatcatcgcgtttggtgcgccaacgaaagctggaacctgtttggct
catggcgcccctttaggaaaagacgagattaccgctacccgaaaagcactaggatggaat
gatgaaccattcatcattacagatgaaatctaccaacattgggatgctacagaagcaggg
gaaaagaaagaaaagatttggaatgatagatttagtgcgtacgaaaaagattttccaaaa
atggcaagtgagtttaaacgccgtataaaaaatgaattacccttaaattggaagatggaa
attcaaggtatcatcaaaagattccaagatcaaccgcaaaatattgcgacccgaaaagct
agtcaaaatacactaaattccttttgtactattctaccagaactaataggtggatctgca
gatctatcaccaagtaatttaacaatttcttcgagatctacatctatttctgataataaa
gatggtaattacattcattatggggtacgcgaatttgctatgaccgctatcgctaacggg
atagctcattatggtggttttttaccttataccgctacatttttaatgtttgttgattat
gcacgtaatgcagtacgtatggctgcgttaatgaaaacccgccatattatgatttatact
cacgattctattggtttaggtgaagacggaccgactcatcaaccgatagaacagttagct
agcttgcgcttaataccaaatataagtgtttggcgtccatgtgatcaagtagaaactgcg
gtttcctggaaaaacgcgattgaaaaaaccaatggtcctactgcgcttattttatctcgt
caaaacctaaaacaacaagatcgaacagaagaacagttggagaatataaccaaaggcgga
tatgttttaaaagattgcttcggaaataaaccagagctaatcttgattgcgaccggatcg
gaagtagagctagcggtaaaggcccataaacaattacagactgaaggttataaaatacga
gttgtatctatgccctctaccgatatttttgatgcacaagacgctacttatcgtgaatta
gtgctaccgaaagcagtaaaattccggattgcgatcgaagctggcatcgctgatttttgg
cataaatatgttggatttgatggaaagatcataggtatgaatagctttggtgaatcagca
ccagcagaaaaattatttgaaatatttggttttacaatagaaaacattataaaacaagca
cgtttattgttaaataaataa

DBGET integrated database retrieval system