KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00115Help
Entry
A35E_00115        CDS       T02336                                 

Definition
(GenBank) peptidyl-tRNA hydrolase
  KO
K01056  peptidyl-tRNA hydrolase, PTH1 family [EC:3.1.1.29]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:sehc03012]
    A35E_00115
Enzymes [BR:sehc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.29  aminoacyl-tRNA hydrolase
     A35E_00115
Translation factors [BR:sehc03012]
 Eukaryotic Type
  Release factors
   A35E_00115
 Prokaryotic Type
   A35E_00115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pept_tRNA_hydro
Motif
Other DBs
NCBI-ProteinID: AFP85431
UniProt: J3VTU1
Position
223188..223787
Genome map
AA seq 199 aa AA seqDB search
MTIKLIVGLSNPQDIYKTTRHNAGAWYLELLAKQYGKTLKKEKKFYGYTTQITLINQNIR
LLLPTTFMNLSGKSVAAIARFYHIDPEYILVAHDELDLLPGRASLKLGGSHNGHNGIKDI
ISSLNGNNLFYRLRIGIGRPDQKNKVIRFVLEKPPKLERQIINGVIDEAIICTKILILQN
LMKAMNRLHAYRPLLISSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaagttaattgtaggattatctaatccacaagatatatacaaaacaacccga
cataatgctggtgcttggtatttagagttactagctaaacagtacggtaaaacattaaaa
aaagaaaaaaaattctatggttatacgactcaaatcacgttaattaatcaaaatatccgc
ttgttactacctacgacttttatgaatttgagcggaaaatcagtagcggctatagctaga
ttttaccatatagatccggaatatattttagttgcacatgatgagcttgatttattacct
ggtcgcgcctctttgaaattaggaggtagccataacggtcataatggtattaaagatatc
atctcttctctaaatgggaataatctattttaccgtttacggattggaattggtcgacca
gatcaaaaaaacaaagtcatacgttttgtgcttgagaaaccacctaaactagaacgtcaa
ataattaatggagttattgatgaagcgataatttgcactaaaattcttatacttcaaaat
ctaatgaaggccatgaatcgcttacatgcttatcgcccgctattgatatcttcgcgataa

DBGET integrated database retrieval system