KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00116Help
Entry
A35E_00116        CDS       T02336                                 

Definition
(GenBank) GTP-binding protein YchF
  KO
K06942  ribosome-binding ATPase
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:sehc03009]
    A35E_00116
Ribosome biogenesis [BR:sehc03009]
 Prokaryotic Type
  Other maturation factors
   A35E_00116
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YchF-GTPase_C MMR_HSR1 FeoB_N TGS Roc
Motif
Other DBs
NCBI-ProteinID: AFP85432
UniProt: J3TGB2
Position
223874..224962
Genome map
AA seq 362 aa AA seqDB search
MGFKCGIVGLPNVGKSTLFNALTHTKVATANFPFCTIEPNVGIVPVPDQRIEQLEKIVQP
KRTVLTTMKFFDIAGLVKGASHGEGLGNKFLANIRETDALCHVVRCFENKEIIHVSNKIC
PTEDINIINTELALSDIESCERAIFRMKKTKARESDINVKILALEKCLFHLNNSRALRTL
DLSSKERNAISFLNLLTLKPTMYLANVNSYDYINNPYLDEVRTIAAHENAAIIVISAQIE
SEIAEFEEKERKEFIKELGLKKSGLEHLIRAGYKLLRLQTYFTAGIKEVRAWTIPISSTA
LQAAGKIHTDFEKGFIRAQIISFSDFIIYKGEKGAKEFGKMRLEGKEYIINDGDIVHFLF
NI
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgggattcaaatgcggtattgttggattacctaacgtaggaaaatcgaccttatttaac
gcgttaacacacacgaaggttgcgacagctaatttcccattttgcacgatcgaaccaaat
gtcggcattgttcctgtacctgatcaacgcattgaacaattagaaaaaatcgtccaacct
aagcgtacagttttaacaaccatgaaattttttgatatcgctggtttagttaaaggtgct
tctcatggagaaggtttaggtaataaatttttagctaatattcgtgagaccgacgctttg
tgtcatgttgtccgttgttttgaaaataaggaaattattcatgtctccaataaaatttgc
cctacagaagatattaacattatcaacaccgaactagctttatctgatatagaatcatgt
gagcgtgctatttttcggatgaagaaaaccaaggctcgagagagtgatatcaatgtaaaa
atattagcgttagagaaatgcctttttcacttaaataattctagagctcttcgtacgctt
gatttgtcttctaaagaaagaaatgccatatcttttctcaacctcttgacgttgaaaccg
acgatgtatttagcaaacgtcaacagttatgattacatcaacaatccctatcttgatgaa
gtacggacgattgcagcacatgaaaatgcagcaataattgtgatatctgctcaaattgaa
tctgagattgctgaatttgaagaaaaagaacgaaaagaatttataaaagaactcggtctt
aaaaaaagtggtttagaacacttaattcgagctggttacaaacttcttagactacaaacc
tatttcacagcaggaattaaagaggttcgagcctggactattccaattagctctaccgca
ttgcaagcagcaggaaaaatacacactgatttcgaaaaaggctttatccgtgctcagatt
atttctttttctgattttattatttataaaggagaaaagggggcaaaagaatttggtaaa
atgcgcttggaggggaaagaatatataataaatgatggtgatatcgtacatttcttattt
aatatttaa

DBGET integrated database retrieval system