KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00122Help
Entry
A35E_00122        CDS       T02336                                 

Definition
(GenBank) UDP-N-acetylmuramate dehydrogenase
  KO
K00075  UDP-N-acetylmuramate dehydrogenase [EC:1.3.1.98]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00520  Amino sugar and nucleotide sugar metabolism
sehc00550  Peptidoglycan biosynthesis
sehc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    A35E_00122
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    A35E_00122
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sehc01011]
    A35E_00122
Enzymes [BR:sehc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.98  UDP-N-acetylmuramate dehydrogenase
     A35E_00122
Peptidoglycan biosynthesis and degradation proteins [BR:sehc01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   A35E_00122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MurB_C FAD_binding_4
Motif
Other DBs
NCBI-ProteinID: AFP85438
UniProt: J3YSX6
Position
235705..236745
Genome map
AA seq 346 aa AA seqDB search
MIMTNTKNLKPLNSFSINISARHIVEVHNEAELYKVWKNAENQSTPTLMLGRGTNVLFLE
NYTGIVLLNRIAGIEIEEQHQAWNLHVGAGEIWDNLVRTCLSKKIPGLENLALIPGCVGA
APIHNIGAYGVEFCQFCNYVDVLHLKTGTLLRLNTNECQFGYRDSIFKHTLRDNHAIVRV
GFQLLKSWNPTLTYGVLKKIHPQHATPQLIYDTICMIRRTTLPDPVLTGNAGSFFKNPII
NAGKAKQLLKEYPDAPNYLQPEGKIKLAAGWLIDQCGLKGYRIGGAATYDKQALILINFN
NATSKDITTLARYIRKKVEKKFAILLEPEVRFIGPLGEVDGIAEII
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgatcatgacaaacaccaaaaatttaaaacccttgaatagcttttctattaatataagc
gcacgacatatagtcgaagtacataacgaagccgaactatacaaagtttggaaaaacgct
gaaaatcaatctacaccaacattaatgctaggtagaggaactaatgtattatttcttgaa
aattatactggaatcgtattgcttaaccgtattgcgggcatagaaatagaagaacaacac
caagcttggaatttacatgttggtgcaggagagatttgggataatttagtacgaacctgt
ctttcaaaaaaaataccaggcttagaaaaccttgcattaatacctggatgcgttggagct
gctcctattcataatattggagcgtatggagtagaattttgtcagttttgcaactatgta
gatgttctacacttaaaaaccggaactttactacgtttaaataccaatgaatgtcaattt
ggttatcgagacagcatttttaaacacaccttacgtgataatcacgctattgttagagtt
ggctttcaacttttaaaatcctggaatcctacattgacttatggtgttctaaaaaaaata
catcctcaacacgccactcctcaacttatttatgacactatttgtatgatacgtcgtaca
acattaccagatccagttctcacaggaaatgcgggaagtttttttaaaaaccctattatc
aatgccggaaaagcaaaacaactgttaaaagaatatcctgatgcacccaactaccttcaa
ccagaaggtaaaataaaactagccgcaggttggttgattgatcaatgtggacttaaagga
tatcgcattggaggagcagcaacatatgataaacaggcacttattttaattaattttaat
aatgcaacgagcaaagatatcaccactctggcacgttatatacgtaaaaaagttgaaaaa
aaatttgcgatcttacttgaacctgaggtccgatttattggacccttgggtgaagtagat
ggaatagcagaaataatatga

DBGET integrated database retrieval system