KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00124Help
Entry
A35E_00124        CDS       T02336                                 

Definition
(GenBank) chaperone protein DnaJ
  KO
K03686  molecular chaperone DnaJ
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:sehc03110]
    A35E_00124
   03029 Mitochondrial biogenesis [BR:sehc03029]
    A35E_00124
Chaperones and folding catalysts [BR:sehc03110]
 Heat shock proteins
  HSP40 / DNAJ
   A35E_00124
Mitochondrial biogenesis [BR:sehc03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    A35E_00124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaJ_C DnaJ DnaJ_CXXCXGXG Anti-TRAP zf-RING_10
Motif
Other DBs
NCBI-ProteinID: AFP85440
UniProt: J3TYJ3
Position
complement(239085..240221)
Genome map
AA seq 378 aa AA seqDB search
MAKLDYYEILGIPKDAEEREIKNAYKRLAMKFHPDRNPGNAEAEAKFKEIKGAYEVLADP
KKRAAYDKYGHSAFEQRCMGEGGGFGGGSSTADFSDLFGDVFGDIFGSNRRQRNRGADLC
YKIELSLEEAVRGVTRQIRIPVLIICDACKGNGTKPGTAPITCSTCNGQGQLQIRQGFFA
VQQTCPNCKGNGKIIKYPCEKCKGHGRVEHAKALMVKIPSGVDTSDRIRLSGKGEEGEHG
SPSGDLYVQIQVRKHPIFEREENNLYCEVPINFAMAALGGEIEVPTLNGKIKLKIPTETQ
TGKLFRMRGKGVKSVRGGAYGDLLCRVVVETPVNLNLNQKKLLSELEESFGKTTGKQNSP
RSQSFIDGVKKFFEDLTR
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaattagactactacgagattttaggtattcctaaggatgcggaagagcgtgaa
atcaaaaatgcctataaacgtctcgcaatgaaatttcacccggatcgcaatccgggaaat
gctgaagctgaagcaaaatttaaagagattaaaggagcttatgaagttctagctgatcca
aaaaaacgagcagcatatgataagtatggtcattcagcatttgaacagcgatgtatgggt
gaagggggaggatttggtgggggttctagtaccgcagattttagtgatctttttggagat
gtatttggtgatattttcgggagtaatcggcgtcaacgtaatcgtggtgcggacttgtgc
tacaaaatagaactttctcttgaggaagcggttcgtggtgttacgcgacaaatccggatc
ccagtacttatcatttgtgatgcttgcaagggtaacggtacgaaaccagggacagcgcct
attacttgttcgacttgtaatgggcaagggcaacttcagatacgtcagggtttctttgca
gtacagcagacatgtcctaattgtaaaggcaatggaaaaataattaaatatccctgcgaa
aaatgtaaaggtcatggtcgagtagagcatgctaaagcattaatggtgaaaattcctagt
ggtgtagatacaagcgatcgtattcgcttgtcaggaaagggagaagaaggagaacatggc
tctccgtcaggagatctttatgtgcaaattcaagtacgtaaacatcctatttttgaacgt
gaagaaaataacttatattgcgaagttcccattaattttgctatggcagcacttggaggt
gaaatagaagtaccaactctcaatggtaaaataaaactaaaaatacctacagaaactcaa
actggaaagcttttccggatgcgtggtaaaggagtaaaatcagttcgtgggggggcatat
ggagatcttctttgccgtgttgttgtagaaacacctgtaaatctcaatttaaaccaaaaa
aaacttctttctgaattggaagaaagcttcggtaaaactactgggaaacaaaatagtcca
cgttcacaaagttttattgatggtgtaaaaaaattttttgaagatttaacccgttaa

DBGET integrated database retrieval system