KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00126Help
Entry
A35E_00126        CDS       T02336                                 

Definition
(GenBank) ribosomal protein L9
  KO
K02939  large subunit ribosomal protein L9
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc03010  Ribosome
Module
sehc_M00178  Ribosome, bacteria
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A35E_00126
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:sehc03011]
    A35E_00126
Ribosome [BR:sehc03011]
 Ribosomal Proteins
  Mitochondria/ Chloroplast
   Large subunit
    A35E_00126
  Bacteria
    A35E_00126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L9_C Ribosomal_L9_N ORF6N
Motif
Other DBs
NCBI-ProteinID: AFP85442
UniProt: J3TGB8
Position
complement(243977..244429)
Genome map
AA seq 150 aa AA seqDB search
MQIILLDKIENLGSLGDQVNVKAGYARNYLVPKGKAVLATKKNIEHFEAYRVKLDAEKAE
MQAIAETRAKKINKLQIITISSKSGEAGKLFGSVGARDIAHAITLAGVNVEKNEVRLPHG
LIRMLGTHEVKIQLHSDVFSTINVVIVPEL
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgcagattattttacttgataaaattgaaaatttgggttctttgggcgatcaagtcaac
gttaaagcaggttatgctcgtaactatctagttccaaaaggaaaagcggtactggccacg
aaaaaaaatatagagcattttgaagcgtatcgtgttaaacttgacgctgagaaagctgaa
atgcaggctattgctgaaactcgcgctaaaaaaattaacaaacttcagataatcacaatt
tcatctaaatcaggagaagcaggtaaactttttggatctgtgggggcgcgcgatattgct
catgctattactcttgcgggtgttaatgtagaaaaaaatgaagttcgactcccccacggt
cttatacgcatgctcggaacacatgaggtaaagatccaacttcatagcgatgttttttct
acaataaatgtagtgatagttccagaattgtaa

DBGET integrated database retrieval system