KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00128Help
Entry
A35E_00128        CDS       T02336                                 

Definition
(GenBank) primosomal replication protein N
  KO
K02686  primosomal replication protein N
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sehc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    A35E_00128
DNA repair and recombination proteins [BR:sehc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     A35E_00128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB
Motif
Other DBs
NCBI-ProteinID: AFP85444
UniProt: J3Z561
Position
complement(244703..245023)
Genome map
AA seq 106 aa AA seqDB search
MMKENCLTLSGIVYKQPIIKVSPSGIFHYHFILDHCSIQREAGFYRKAWCRLSVIISGKE
SLKITSNIINKAKITVRGFISCHQGRNGLNKIVLHAKTVDSIYSGD
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaagaaaattgtttaactttatcgggtattgtatacaaacaacctattattaaa
gttagtccatctggaatttttcattaccattttattcttgatcattgttccatacaacgg
gaagctggtttttatcgaaaagcatggtgtcgactctctgtaataataagtggtaaagaa
tcattgaaaattacatcgaatataatcaataaggcgaagatcactgtacgcggctttatt
agttgtcatcaagggcgtaatggtcttaataaaatagttctacacgccaagactgttgat
tcaatatattctggagattaa

DBGET integrated database retrieval system