KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00134Help
Entry
A35E_00134        CDS       T02336                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K00097  4-hydroxythreonine-4-phosphate dehydrogenase [EC:1.1.1.262]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00750  Vitamin B6 metabolism
sehc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    A35E_00134
Enzymes [BR:sehc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.262  4-hydroxythreonine-4-phosphate dehydrogenase
     A35E_00134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA
Motif
Other DBs
NCBI-ProteinID: AFP85449
UniProt: J3Z564
Position
255057..256049
Genome map
AA seq 330 aa AA seqDB search
MINYHRIVITPGEPAGIGPDIVSVLAQETWPVELVICADPFMLEARARQLYLPLRLRPYC
STQAPTLRPSGELSILPVLTEKPVVSGTLNALNSDYVIKTLERAHDGCLNGEFSALVTGP
VNKGIINTSGLAFSGHTEYFSQRSGCNKVVMLLATKLLRVALATTHLPLLKVSSAITRNS
LKDTITILAQGMKKKFGITVPCIYVCGLNPHAGEGGYLGKEEIDVIIPTLDALRKSGYNL
VGPLPADTLFQKKYLRKSDVILAMYHDQGLPVLKYHGFGRAANITLGLPFIRTSVDHGTA
IELAGSGQAKANSIKKALTYAIEMIHHDYK
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgattaattatcatcgaattgttattactccaggtgaaccagccggaataggtcctgat
attgtatctgtgctcgcacaagaaacatggcccgtagagctagttatctgcgctgatcct
tttatgcttgaagcgcgagcgagacaactctatttaccgcttcggcttcgaccttattgc
tcaacacaagcgcctactttaagaccatcaggagaactttcaatacttccagttttaaca
gaaaaaccagttgtcagtggaacattaaacgcattaaacagtgattacgttataaaaact
ttagaacgtgcacatgatggatgtttaaatggtgaattctccgctttagttacaggacca
gtaaataaaggtattattaatacaagtggattagcatttagtggtcatacagaatatttt
tctcaacgtagtggatgtaataaggtcgtgatgctgctagctactaaactactacgcgtt
gcattggctactacccatttacccttattaaaagtatcttcagccattaccagaaattca
ctaaaagatactataacaattttagcacagggtatgaaaaaaaaattcggtataactgta
ccatgtatctacgtctgtggtcttaatccccatgccggtgaagggggctatcttggaaaa
gaagaaatagatgtgataattccaactttagatgctctacgtaaaagtggttataattta
gtaggtccacttcctgcagacacgttatttcaaaaaaaatatttacgaaaatcagatgtt
atattggccatgtatcatgatcaaggattacctgtattaaagtaccatggatttgggcgt
gccgcaaatatcactttaggactcccatttattcgtacttctgtcgatcatggcacagca
atagagcttgccggttccggtcaagcaaaggctaatagtattaaaaaagcacttacatat
gctatagagatgatacatcatgactataaataa

DBGET integrated database retrieval system