KEGG   Secondary endosymbiont of Heteropsylla cubana: A35E_00490Help
Entry
A35E_00490        CDS       T02336                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
sehc  Secondary endosymbiont of Heteropsylla cubana
Pathway
sehc00270  Cysteine and methionine metabolism
sehc00480  Glutathione metabolism
sehc01100  Metabolic pathways
Module
sehc_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:sehc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    A35E_00490
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A35E_00490
Enzymes [BR:sehc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     A35E_00490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST DUF4508 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: AFP85780
UniProt: J3TZ72
Position
complement(864870..865826)
Genome map
AA seq 318 aa AA seqDB search
MIKLGIVMDPISTINIQKDTSFAMLLEAQNRGYKIYYMEMNSLYLSAGKARASTQVLSVK
KEHTPYYTFNNEEDINLEMLDIILMRKNPPFDRDFLYATYILEIAEHQGVLVVNKPQSLR
DCNEKLFTMWFPKYTPDTLVSKKDAHLRAFWKKHGDIILKPLNGMGGQSIFHIKSRDPNL
TVIIENLTGYGRNFCMAQNYLPSIKDGDKRVFVIDGKTIPYCLARIPKIGETRGNLIAGG
QGEVRPLTKNDWKIADALAPTLKKKGLIFVGLDIIGQHLTEINVTSPTCVCEIEAAFPIS
INGILLDAIEKRIILKKR
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgattaagcttggaattgtaatggatccgatttctacaattaatattcaaaaagacact
agctttgctatgcttctagaagcacaaaatcgtggttataaaatttattacatggaaatg
aactccctatatctatcagctggtaaagcgagagcctcaactcaagtactttctgtaaaa
aaagaacatacaccctattacacatttaacaatgaagaggatatcaatcttgagatgtta
gatatcatcttaatgcgtaaaaacccaccttttgaccgtgattttttatatgctacttat
attctcgaaatagctgaacatcaaggggttcttgttgtcaataaaccacaaagtttgcga
gactgtaacgaaaaattatttaccatgtggtttccgaaatataccccagataccctggta
agcaaaaaagatgcacatcttcgcgcattttggaagaaacacggtgacattatcttaaaa
cctctcaatggtatgggcggtcaatcaatttttcatattaaatcaagagatccaaaccta
acagtaattattgaaaatcttactggttacggacgtaatttttgtatggctcaaaattat
ttaccgtctattaaagatggggataaacgagtatttgtgatagacggtaaaacgatccct
tactgtttagcacgaattcctaaaattggtgaaactcgtggcaatcttatcgctggtggg
cagggtgaagtacgaccgttaactaaaaatgattggaaaatagctgacgctttagctccg
acgttgaagaaaaaaggacttatctttgttggactagatataatagggcagcacctaact
gaaattaatgtcactagtcctacttgcgtgtgcgaaatcgaggctgcctttcctatttct
attaatggaatactattagatgcaattgaaaaacgcataattttaaaaaaacgctaa

DBGET integrated database retrieval system