KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0283Help
Entry
SPC_0283          CDS       T00862                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Brite
KEGG Orthology (KO) [BR:sei00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sei02044]
    SPC_0283
Secretion system [BR:sei02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPC_0283
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VipA RseA_N
Motif
Other DBs
NCBI-ProteinID: ACN44471
UniProt: C0Q6P2
Position
309955..310497
Genome map
AA seq 180 aa AA seqDB search
MAINNSAQKFIARNRAPRVQIEYDVEIYGSEKKIELPFVMAVLADLAGKPREELPPVTDR
KFLDIDIDNFNERMKAIAPRVAFAVPNTLTGEGQLMVDITLENMDDFSPAQIARKVDALN
QLLEARTQLENLQTYMDGKAGAENLVNKLLQDPTLLKTLANAPKPAATQQGVSADNESAE
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggctatcaacaatagcgcgcagaaattcatcgcgcgcaaccgcgcgccgcgcgtgcag
attgaatatgacgtagagatttacggctctgagaaaaaaatcgagctgccgttcgtgatg
gcggtgctggccgatctggccgggaaaccgcgtgaagaactgccgccggtgacggatcgc
aaattcctcgatattgatattgataacttcaatgagcgcatgaaagccattgcgccgcgc
gtggcgttcgctgtgccgaatacgctgacgggtgaaggtcagttgatggtcgatatcacg
ctggaaaatatggacgacttttcgccggcacagattgcccgcaaggtggacgccctgaac
cagttactggaagcccgcacccaactggagaacctccagacctacatggatggtaaggcc
ggggcggaaaatctggtcaataaactgttgcaggacccgaccctgctgaaaacgctggcg
aatgcgccgaaaccggccgctacccagcaaggtgtgtcagcggataatgaatcagcggaa
taa

DBGET integrated database retrieval system