KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_0646Help
Entry
SPC_0646          CDS       T00862                                 

Gene name
ybeM
Definition
(GenBank) putative hydrolase
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Brite
KEGG Orthology (KO) [BR:sei00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPC_0646 (ybeM)
Enzymes [BR:sei01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     SPC_0646 (ybeM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CN_hydrolase
Motif
Other DBs
NCBI-ProteinID: ACN44823
UniProt: C0PW60
Position
685041..685829
Genome map
AA seq 262 aa AA seqDB search
MFVAAGQFVVSSVWEKNAQVCVSLMAQAAGRGVSLLVLPEGILARNDIDLDLPIRAAQPL
DGAFMTRLLEESAHNNMTTIFTILVPPTPGRAVNMLVALRAGHIVARYAKLHLYDAFSMQ
ESQSIDAGTVIAPVLDVEGVKVGLMTCYDLRFPDMALALALQGADVLALPTGWVRGPLKE
QQWSTLLAARALDTTCYMIAAGECGNRNIGQSRIIDPLGVTIAAAADRPALIVAEIFRER
IDQVREQLPLLQQRRFAPPQLL
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgcagccgggcagtttgtggtgagttctgtatgggaaaagaatgcgcaagtt
tgcgtttcgttaatggctcaggcggcgggccgcggcgtatcgcttctggtgctgcctgag
gggatattagcgcgaaatgacatcgaccttgacctgccgattcgcgccgcgcagccgctg
gatggcgcgtttatgacgcggcttctggaagaaagcgctcataataatatgacgacgata
ttcactatccttgtcccgccaacgcctggacgggcggttaatatgctggtggcgctacgg
gcgggtcacattgtcgcgcgttacgcgaagctgcatctctatgatgcgttttcgatgcaa
gaatcccaaagtattgatgccggaaccgttatcgcgcctgtgctggacgtggagggggtt
aaggtggggcttatgacctgttatgacctgcgctttccggatatggcgttagcgctggct
ttacagggggctgacgtattggcgctgccgacgggctgggttcgcggcccgttgaaagag
cagcagtggtcgacgctgctggcggcgagagcgctggataccacctgctatatgattgcg
gccggggagtgtggtaatcgtaatattggtcaaagtcgtattatcgatccgttgggggta
acgatagccgcggcagccgatcgtccggcgctgatcgtcgcggaaatattcagagaacga
atagaccaggtgcgggagcaacttcctcttttgcagcaacgacgatttgcgccaccgcaa
ttattatga

DBGET integrated database retrieval system