KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1108Help
Entry
SPC_1108          CDS       T00862                                 

Gene name
nifS
Definition
(GenBank) cysteine desulfurase
  KO
K04487  cysteine desulfurase [EC:2.8.1.7]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00730  Thiamine metabolism
sei01100  Metabolic pathways
sei04122  Sulfur relay system
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    SPC_1108 (nifS)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04122 Sulfur relay system
    SPC_1108 (nifS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:sei03016]
    SPC_1108 (nifS)
   03029 Mitochondrial biogenesis [BR:sei03029]
    SPC_1108 (nifS)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:sei02048]
    SPC_1108 (nifS)
Enzymes [BR:sei01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.7  cysteine desulfurase
     SPC_1108 (nifS)
Transfer RNA biogenesis [BR:sei03016]
 Eukaryotic Type
  tRNA modification factors
   Thiolation factors
    SPC_1108 (nifS)
 Prokaryotic Type
    SPC_1108 (nifS)
Mitochondrial biogenesis [BR:sei03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Proteins involved in Fe-S cluster biogenesis
    SPC_1108 (nifS)
Prokaryotic defense system [BR:sei02048]
 DNA phosphothiolation system
  Sulfur modification proteins
   SPC_1108 (nifS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: ACN45274
UniProt: C0PYK7
Position
1152569..1153783
Genome map
AA seq 404 aa AA seqDB search
MKLPIYLDYSATTPVDPRVAEKMMQFLTLDGTFGNPASRSHRFGWQAEEAVDIARNQISE
LVGADPREIVFTSGATESDNLAIKGAANFYQKKGKHIITSKTEHKAVLDTCRQLEREGFE
VTYLAPQRNGIIDLNELEAAMRDDTILVSIMHVNNEIGVVQDIATIGEMCRARGIIYHVD
ATQSVGKLPIDLSQLKVDLMSFSGHKIYGPKGIGALYVRRKPRIRIEAQMHGGGHERGMR
SGTLPVHQIVGMGEAYRIVKEEMETEMARLRGLRNRLWNGIKDIEEVYLNGDLEQGAPNI
LNVSFNYVEGESLIMALKDLAVSSGSACTSASLEPSYVLRALGMNDELAHSSIRFSLGRF
TTEEEIDYTIDLVRKSIGRLRDLSPLWEMYKQGVDLNSIEWAHH
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaccgatttatctcgactactccgcaaccacgccggtggacccgcgtgttgcc
gagaaaatgatgcagtttctgaccctggacggaacctttgggaacccggcgtctcgttca
caccgtttcggctggcaggctgaagaagccgtcgatatcgcccgcaaccagatttctgaa
ctggtcggcgccgacccgcgtgaaatcgtctttacctcaggggcgacggagtccgataac
ctggcgatcaaaggcgctgccaacttttatcagaaaaaaggcaagcacatcatcaccagc
aagaccgagcacaaagcggtgctggacacctgccgtcagcttgagcgcgaagggtttgaa
gtgacctacctggcgccgcagcgcaacggcatcatcgatctcaacgagctcgaagcagcg
atgcgtgacgacaccattctggtttccatcatgcacgtgaacaacgaaatcggcgtggtg
caggatatcgcgaccatcggcgaaatgtgccgcgcgcgcggtatcatctaccacgttgac
gccacccagagcgtgggcaaactgcctatcgacctgagccaactgaaagtggatctgatg
tccttctccggtcataaaatttatggtccgaaaggcattggcgcgctgtatgtgcgtcgt
aagccgcgtattcgcattgaagcgcagatgcatggcggcgggcacgaacgcggtatgcgc
tctggtactctgcctgtccaccagatcgtcggcatgggcgaagcttaccgtatcgtgaaa
gaagagatggagaccgaaatggcccgtctgcgcggtctgcgtaaccgtctgtggaacggc
atcaaagatattgaagaagtttacctgaacggcgaccttgagcagggcgcgccaaacatt
ctcaacgtgagctttaactacgttgaaggcgagtcgctgattatggcgctgaaagacctg
gcggtctcttccggttccgcctgtacatccgccagtctggaaccgtcttacgtgctgcgc
gcgttgggcatgaatgacgagctggcgcatagctctatccgtttctctttaggtcgtttt
accactgaagaagagatcgactacaccattgatctggttcgtaaatccattggccgtctg
cgtgacctttctccactgtgggaaatgtacaagcagggtgtggatctgaacagcatcgaa
tgggcacatcattaa

DBGET integrated database retrieval system