KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_1317Help
Entry
SPC_1317          CDS       T00862                                 

Gene name
yfcX
Definition
(GenBank) putative fatty acid oxidation complex alpha subunit
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00071  Fatty acid degradation
sei00280  Valine, leucine and isoleucine degradation
sei00281  Geraniol degradation
sei00310  Lysine degradation
sei00362  Benzoate degradation
sei00380  Tryptophan metabolism
sei00410  beta-Alanine metabolism
sei00640  Propanoate metabolism
sei00650  Butanoate metabolism
sei00903  Limonene and pinene degradation
sei00930  Caprolactam degradation
sei01040  Biosynthesis of unsaturated fatty acids
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01120  Microbial metabolism in diverse environments
sei01130  Biosynthesis of antibiotics
sei01200  Carbon metabolism
sei01212  Fatty acid metabolism
Module
sei_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SPC_1317 (yfcX)
   00650 Butanoate metabolism
    SPC_1317 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    SPC_1317 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    SPC_1317 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPC_1317 (yfcX)
   00310 Lysine degradation
    SPC_1317 (yfcX)
   00380 Tryptophan metabolism
    SPC_1317 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPC_1317 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPC_1317 (yfcX)
   00281 Geraniol degradation
    SPC_1317 (yfcX)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SPC_1317 (yfcX)
   00930 Caprolactam degradation
    SPC_1317 (yfcX)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SPC_1317 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SPC_1317 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SPC_1317 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ACN45480
UniProt: C0PZX6
Position
1379983..1382109
Genome map
AA seq 708 aa AA seqDB search
MLNVRLDNVAVVAIDVPGEKVNTLKAEFAAQVRAILKQIRENKALQGVVFISAKADNFIA
GADINMIGHCQNAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRI
CTDDVKTVLGLPEVQLGLLPGSGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDD
VVPQTILLEAAVELAKKERLAQRTLPVRERILAGPLGRALLFRLVRKKTAQKTQGNYPAT
ERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAIFFASTKVKKDPGSDAPPGP
LNSVGILGGGLMGGGIAWVTACKGGLPVRIKDINTQGINHALKYSWDLLETKVRRRHIKA
SERDKQLALISGSTDYRGFSHRDLVIEAVFEDLPLKQQMVAEVEQNCAAHTIFASNTSSL
PIGDIAANAARPEQVIGLHFFSPVEKMPLVEVIPHASTSAQTIATTVKLAKKQGKTPIVV
SDKAGFYVNRILAPYINEAIRMLTEGERVEHIDAALVKFGFPVGPIQLLDEVGIDTGTKI
IPVLEAAYGECFSAPANVVASILNDDRKGRKNGRGFYLYGEKGRKSKKQVDPAIYKLIGV
QGQSRLSAQQVAERCVMLMLNEAARCFDEKVIRSARDGDIGAVFGIGFPPFLGGPFRYMD
ALGPGEMVATLQRLAALYGPRYAPCEQLVRMAERREHFWTNGETDQGN
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgcttaacgtgcgtctggataatgtcgcggttgtcgctattgatgtccctggagaaaag
gtgaacaccctgaaagcggagtttgccgcgcaggtacgcgccatcctgaagcagatccgg
gaaaataaagcgttgcagggcgttgtttttatttcagccaaagcagataactttattgct
ggcgctgatatcaacatgataggtcactgccaaaacgcgcaggaagcggaaacgctggcg
cgtcaggggcaacaactgatggcggagatccaggcgttgcctgttccggttatcgccgcc
attcacggcgcctgcctggggggcggtcttgaaatggcgctggcctgccatcggcgcatc
tgtaccgatgacgttaaaaccgttctcggactgccggaggtacagttagggcttttaccg
ggatcgggcggaacgcagcgtcttccacggctggtgggggtcagtaccgcgctggatatg
atcctgacaggtaaacagcttcgcgccagacaggcgcttaaagccgggctggttgatgat
gtggtgccgcaaaccattttactggaagcggctgtcgagctggctaaaaaagaacgtctg
gcgcagcggacattaccggtccgggaacgtatcctggcggggccgttgggacgcgcgctg
ttatttcgcctggtgcgtaaaaagacggcgcaaaaaacgcagggtaattatccggcgacg
gagcggatcattgatgtgattgaaactggactggcgcagggcagcagtagcggctatgac
gcggaagcgcgcgctttcggcgagctggcgatgacgcctcaatcgcaggcgctgcgcgct
attttctttgccagtaccaaggtgaaaaaagatcccggtagcgatgcgccgcccggcccg
ctgaacagcgtgggcatcttaggcggcgggttaatgggcggcggtatcgcctgggttacg
gcctgtaaaggcggcttgccagtacgaattaaggatataaatactcaggggatcaatcat
gctctgaagtacagctgggatctgcttgaaacaaaagtacgccgccgccatatcaaagcc
agcgaacgcgataaacagttggcgttgatatcaggttcgaccgattaccgtggtttcagt
catcgtgatctggtcattgaagcggtgtttgaagatctgccgttaaaacaacagatggtg
gcggaagtggagcaaaattgcgctgctcacaccatttttgcctccaatacttcttccctg
ccgattggcgatattgcggcgaatgcggccagaccggaacaggtgattggattgcacttt
tttagcccggtcgaaaaaatgccgctggttgaggttattcctcatgcgtctacttccgcg
cagaccatcgccacgaccgttaagctggcgaaaaaacagggtaaaaccccgatagtcgtc
agtgataaagccgggttttatgttaaccgaattcttgcgccgtatatcaatgaggcgatt
cggatgctgactgaaggcgaacgcgtcgaacatattgacgccgccctggtaaaatttggt
tttccggtggggccaatccaacttttggatgaggtaggaatcgacacgggcactaaaatt
attcctgtgcttgaggcggcgtatggagaatgttttagcgcacctgcaaatgttgtcgct
tcaattttgaatgacgatcgcaaaggtagaaaaaatggtcgcggtttctatctttatggc
gaaaaagggcgtaaaagcaaaaaacaggttgaccctgctatttataagcttattggcgtg
caagggcagagtcgactgtctgcgcagcaggtggcagagcgctgtgtcatgttaatgctt
aacgaagcggcgcgctgtttcgacgaaaaagtgattcgcagcgcgcgcgatggcgatatt
ggcgccgtgtttggtatcggttttccgccgtttctcggtggcccgttccgctatatggat
gctctcgggccgggtgaaatggtggcgacattacagcgcctggccgcactttacggtcct
cgttacgcgccttgtgaacaattagtgcgcatggcggagcgcagggagcatttctggacg
aatggggaaactgaccagggaaattga

DBGET integrated database retrieval system