KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2615Help
Entry
SPC_2615          CDS       T00862                                 

Gene name
ycdW
Definition
(GenBank) putative 2-hydroxyacid dehydrogenase in phoh-csgg intergenic region
  KO
K12972  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00260  Glycine, serine and threonine metabolism
sei00620  Pyruvate metabolism
sei00630  Glyoxylate and dicarboxylate metabolism
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    SPC_2615 (ycdW)
   00630 Glyoxylate and dicarboxylate metabolism
    SPC_2615 (ycdW)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPC_2615 (ycdW)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     SPC_2615 (ycdW)
    1.1.1.81  hydroxypyruvate reductase
     SPC_2615 (ycdW)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C NAD_binding_2 NAD_Gly3P_dh_N
Motif
Other DBs
NCBI-ProteinID: ACN46717
UniProt: C0Q872
Structure
PDB: 

Position
complement(2649646..2650584)
Genome map
AA seq 312 aa AA seqDB search
MEIIFYHPTFNAAWWVNALEKALPHARVREWKVGDNNPADYALVWQPPVEMLAGRRLKAV
FVLGAGVDAILSKLNAHPEMLDASIPLFRLEDTGMGLQMQEYAVSQVLHWFRRFDDYQAL
KNQALWKPLPEYTREEFSVGIMGAGVLGAKVAESLQAWGFPLRCWSRSRKSWPGVESYVG
REELRAFLNQTRVLINLLPNTAQTVGIINSELLDQLPDGAYVLNLARGVHVQEADLLAAL
DSGKLKGAMLDVFSQEPLPQESPLWRHPRVAMTPHIAAVTRPAEAIDYISRTITQLEKGE
PVTGQVDRARGY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggagataattttttatcacccgacatttaacgccgcctggtgggtaaatgcgctggag
aaggctctcccacatgcgcgcgttcgtgaatggaaggtcggtgataacaaccccgcagac
tatgcgcttgtatggcagcccccggttgaaatgctggccggaagacgcttaaaagccgtc
tttgtgctgggcgcgggggtggatgcaattctgagtaaattaaatgcgcatccggaaatg
ctggacgcctccattcctctattccgtctggaagataccggaatgggcctgcaaatgcag
gagtatgccgtcagccaggtattacactggttccgccgtttcgatgattatcaggcgctg
aaaaatcaggcgctatggaaaccgttgccggaatatacccgcgaagaatttagcgtcggt
atcatgggcgcaggggtactgggcgcaaaagtggcagaaagtctacaggcgtgggggttc
ccgttacgttgctggagtcgtagccgcaaatcttggcctggcgtggaaagttatgtaggg
cgtgaagagctgcgcgctttcctgaaccagacgcgggtgctgattaatctgctgccgaat
acggcccaaacggtaggaattattaatagcgaattgttggatcaattgccggatggcgct
tacgtgctgaacctcgcgcgcggcgtgcatgttcaggaggcggatctgctggctgcactt
gatagcggtaagctaaaaggcgcgatgttggatgtctttagccaggaaccgttaccgcag
gaaagtccattatggcgccatccgcgagtcgccatgacgccgcacattgcggcagtcacc
cgtccggcggaagccatcgattatattagccgcaccattacccagctggagaagggagag
ccggtgacggggcaggtggatcgggcgagaggatattga

DBGET integrated database retrieval system