KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2655Help
Entry
SPC_2655          CDS       T00862                                 

Gene name
copS
Definition
(GenBank) histidine kinase
  KO
K02484  two-component system, OmpR family, sensor kinase [EC:2.7.13.3]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Brite
KEGG Orthology (KO) [BR:sei00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sei01001]
    SPC_2655 (copS)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sei02022]
    SPC_2655 (copS)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SPC_2655 (copS)
Protein kinases [BR:sei01001]
 Histidine kinases
  OmpR family
   SPC_2655 (copS)
Two-component system [BR:sei02022]
 OmpR family
  Unclassified
   SPC_2655 (copS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_5 HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: ACN46756
UniProt: C0Q8B1
Position
2691639..2692988
Genome map
AA seq 449 aa AA seqDB search
MTLRLTISFIAILILACTGISWTLYNALSKELTYRDDMTLINRAAQMQQLLLDGARPENL
PLYFNRMVDTKQDILLIHSATGHNVAINHSGIPDQRFNEIPLAKNITRETLFRQAVQGTE
LTAVRVNARSGDDPLTLTIARLATERRQMLAQYRRNSLLISLIAILVCSALSPLVIRNGL
RAITSLSRLTAATDSGTLRQPLAEQALPVELRPLGQALNTMRQKLSDDFERLNQFADDLA
HELRTPVNILLGKNQVMLSQERSAEEYQQALVDNIEELEGLSRLTENILFLARAEHQNIA
VKKQPVSLNALVENMLDYLSPLAEEKRICFINQCQGTVWADEILLQRVLSNLLTNAIRYS
DENAVIRIESAYDDNVAEIRVANPGSHPADADKLFRRFWRGDNARHTAGFGLGLSLVNAI
ALLHGGSASYRYADEHNIFSVRLPDSGDS
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacgctgcgcctgacaatttcttttatcgccatccttatcctcgcctgtaccggcatt
agctggacgctctataacgcgttgagcaaagaattaacgtatcgggatgatatgacgcta
ataaatcgggcggcgcaaatgcagcaactgttactggatggcgccaggccggaaaatctg
ccgctctatttcaatcggatggtggatacgaagcaggatatcttattgatccattcagca
acaggccacaatgttgcgattaatcatagcggcatccccgaccaacgctttaacgagatt
ccgctggctaaaaacatcacccgcgaaaccttatttcgccaggcggtacaaggcacggaa
cttaccgcggtacgagtaaacgccagaagcggcgatgacccgctgacccttactattgcc
aggctggcgacggaaaggcggcaaatgctggcgcaatatcgccgtaacagtttgctgatt
agccttatcgcgatcctcgtctgttcggcgctcagtccattagtcatcagaaacgggctg
cgggccattacgtcgctcagccgactcaccgcggcgacagatagcggcacacttcgccag
ccgttggcggaacaggcgttacccgtcgagctaaggccgcttggacaagcgctaaatact
atgcgccagaagctttccgacgattttgaacgcctgaaccaatttgccgacgatctggcg
catgagctgcgcacgccggttaatattttactggggaagaatcaggtgatgctgagtcag
gaacgcagcgccgaagagtatcaacaagcccttgtcgataatattgaagagctggaggga
ctgtcgcgactgacagaaaatattctctttctggcacgcgcggagcaccagaatatagcg
gtaaaaaaacagcctgtttcgctcaatgcgctggtcgaaaatatgctggattatcttagc
ccccttgccgaggagaagcgcatctgttttataaatcaatgtcagggaacggtatgggct
gacgaaatattattacaaagagtgctctcaaacctgctgacgaatgccatccgttattct
gatgaaaacgccgtgatacgtattgaaagcgcttatgatgataacgttgcagaaattcgg
gtcgctaatccgggcagccaccccgccgatgcggataagcttttccggcgtttttggcga
ggagataatgcccgccacactgccggtttcggcctggggttatcgttagttaacgcgatt
gctctattacacggtggttcggcatcttaccgctatgccgatgaacataatatcttttcg
gttcgtctgcccgatagcggtgatagctaa

DBGET integrated database retrieval system