KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_2680
Entry
SPC_2680          CDS       T00862                                 

Gene name
ycbG
Definition
(GenBank) hypothetical protein
  KO
K09911  uncharacterized protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Brite
KEGG Orthology (KO) [BR:sei00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    SPC_2680 (ycbG)
SSDB
Motif
Pfam: MatP MatP_C RHH_4 TMF_TATA_bd
Other DBs
NCBI-ProteinID: ACN46781
UniProt: C0Q8D6
Position
complement(2714376..2714828)
AA seq 150 aa
MKYQQLENLESGWKWKYLVKKHREGELITRYVEASAAQEAVNLLLALENEPVRVNVWIDR
HMNPALLNRMKQTIRARRKRHFNAEHQHTRKKSIDLEFMVWQRLAGLAQRRGKTLSETIV
QLIEDAEHKEKYATQMTTLKQDLQALLGKK
NT seq 453 nt   +upstreamnt  +downstreamnt
atgaaatatcaacaacttgaaaatcttgaaagcggttggaaatggaaatatctggtgaaa
aagcaccgcgaaggggagttgatcacccgctacgtggaagccagtgctgcccaggaagcc
gtcaatttgttgttggccctcgaaaatgaaccggtgcgggtaaacgtctggatagacagg
catatgaatcctgccttgcttaatcggatgaaacaaaccattcgggcaagacgcaaacga
cacttcaatgcggaacatcagcatacgcgcaaaaaatctatcgatttagagtttatggtc
tggcagcgtctggcgggccttgcgcagcgacgcggtaaaacattatccgaaacgatagtg
caactgatagaagacgcggagcataaagagaaatatgccacgcaaatgaccacgttaaag
caggatttacaggcgttattaggcaagaagtaa

DBGET integrated database retrieval system