KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3198
Entry
SPC_3198          CDS       T00862                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:sei00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    SPC_3198
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sei02044]
    SPC_3198
Secretion system [BR:sei02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   SPC_3198
SSDB
Motif
Pfam: T6SS_HCP
Other DBs
NCBI-ProteinID: ACN47283
UniProt: C0PYA9
Position
complement(3228676..3229161)
AA seq 161 aa
MDAIFLKLDNIKGESQVEGFEDQIEIMSYSHNVAMQVNNDVSLTERTSGRAHVGEMSLTK
FVDLATPVLNEYCCSGRLIRTAVLTLCRNDDGKMRSLIVYTLTNVLISQLSVSGGAGGKP
VETMSLNFTKIEWQVTAEKSDGAQQESRASVWDLAMDQIGK
NT seq 486 nt   +upstreamnt  +downstreamnt
atggatgcgatttttttaaagctcgacaatatcaaaggcgaaagccaggttgaaggcttt
gaagatcagatagagatcatgtcttatagccacaatgtggcaatgcaggtaaataacgat
gttagcctcactgagcggacttccgggcgtgcgcatgttggtgaaatgtcgctcaccaaa
tttgtcgacctcgccacgcctgtgctcaatgagtactgctgtagcgggaggctaattaga
acagcggtgctgacgttgtgccgcaatgacgacggcaaaatgcggtcgcttatcgtttat
accctgacaaacgtgctgatatcacaactcagtgttagcggcggcgccggcggtaagccg
gtggaaacgatgtcgctgaacttcacgaaaatcgaatggcaagtcactgccgagaaatca
gacggcgctcaacaggagtccagagcgtcagtatgggatctggcgatggaccagataggg
aaatga

DBGET integrated database retrieval system