KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3570Help
Entry
SPC_3570          CDS       T00862                                 

Gene name
envZ
Definition
(GenBank) osmolarity sensor protein
  KO
K07638  two-component system, OmpR family, osmolarity sensor histidine kinase EnvZ [EC:2.7.13.3]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sei00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    SPC_3570 (envZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sei01001]
    SPC_3570 (envZ)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:sei02022]
    SPC_3570 (envZ)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     SPC_3570 (envZ)
Protein kinases [BR:sei01001]
 Histidine kinases
  OmpR family
   SPC_3570 (envZ)
Two-component system [BR:sei02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   SPC_3570 (envZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HATPase_c HisKA HAMP HATPase_c_2 HATPase_c_3
Motif
Other DBs
NCBI-ProteinID: ACN47653
UniProt: C0Q0H6
Position
complement(3590257..3591600)
Genome map
AA seq 447 aa AA seqDB search
MRFSPRSSFARTLLLIVTLLFVSLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQ
LEDGTQLVVPPAFRREIYRELGISLYTNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVR
VEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQN
RPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSH
DLRTPLTRIRLATEMMGEEDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNS
VLGEVIAAESGYEREINTALQAGSIQVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTE
SHRAWFQVEDDGPGIKPEQRKHLFQPFVRGDSARSTSGTGLGLAIVQRIIDNHNGMLEIG
TSERGGLSIRAWLPVPVARVQGTTKEA
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttctcgccgcgaagttcatttgcccgcacgctgttgctcatcgtcaccttgctg
ttcgtcagcctggtgacgacctacctggtggtgttgaacttcgcgattttgccgagcctc
cagcagtttaataaggttctggcttacgaagtccgtatgctgatgaccgataagctgcaa
ctggaggacggcacgcagttagtcgtgccgcctgcgtttcgccgggaaatctatcgcgag
ctggggatctctctctacaccaacgaagccgctgaagaggccgggctgcgttgggcgcaa
cactacgaattcttaagccaccagatggcgcagcaattaggcggcccgacggaagtgcgc
gttgaggtcaacaaaagctcgcctgtcgtgtggctcaaaacctggctgtcgcccaatatc
tgggtgcgcgtgccgctgaccgagattcatcagggcgatttttctccgcttttccgttac
acgctggcgatcatgctcctggcgataggcggcgcgtggctgtttattcgtatacagaat
cgaccgttagtggatctggaacatgccgccttgcaggtagggaagggaattattccgccg
ccgctgcgtgaatatggcgcctctgaggtgcgctctgtgacccgggcgtttaaccatatg
gccgccggcgtgaaacaattggccgatgaccgtacgctattgatggcgggcgtcagccac
gacttgcgcacgccgctgacccgtattcgtctggcgacggagatgatgggcgaggaagac
ggttatctcgcggagtcgatcaataaagacatcgaagagtgtaacgccattatcgaacag
tttattgactatctgcgtaccggtcaggaaatgccaatggagatggcggatctcaattcc
gtgctgggcgaggtgattgcggcggaaagcggctatgagcgtgagattaacactgcgctt
caggcaggcagtatccaggtgaaaatgcacccgctctcgattaagcgcgcggtggcgaat
atggtggtcaatgctgcccgctatgggaacggctggattaaggtcagcagcggcaccgag
tcgcatcgcgcctggttccaggtagaagatgacgggccgggcattaagccggagcagcgt
aaacatctgttccagccttttgtgcgtggcgacagcgcccgtagcaccagcggcacaggg
ctagggctggcgattgtgcagcgcattatcgataaccataacgggatgctggagattggc
accagcgagcgtggcggcttgtcaattcgcgcctggctaccggttcctgtggctcgcgtc
caggggacgacaaaagaggcataa

DBGET integrated database retrieval system