KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_3725Help
Entry
SPC_3725          CDS       T00862                                 

Gene name
yiaE
Definition
(GenBank) 2-hydroxyacid dehydrogenase
  KO
K00090  glyoxylate/hydroxypyruvate/2-ketogluconate reductase [EC:1.1.1.79 1.1.1.81 1.1.1.215]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00030  Pentose phosphate pathway
sei00260  Glycine, serine and threonine metabolism
sei00620  Pyruvate metabolism
sei00630  Glyoxylate and dicarboxylate metabolism
sei01100  Metabolic pathways
sei01110  Biosynthesis of secondary metabolites
sei01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SPC_3725 (yiaE)
   00620 Pyruvate metabolism
    SPC_3725 (yiaE)
   00630 Glyoxylate and dicarboxylate metabolism
    SPC_3725 (yiaE)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SPC_3725 (yiaE)
Enzymes [BR:sei01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     SPC_3725 (yiaE)
    1.1.1.81  hydroxypyruvate reductase
     SPC_3725 (yiaE)
    1.1.1.215  gluconate 2-dehydrogenase
     SPC_3725 (yiaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: ACN47803
UniProt: C0Q1A7
Position
3770871..3771845
Genome map
AA seq 324 aa AA seqDB search
MKPSIILYKTLPDDLLHRLEAHFTVTQVPNLHPETVARHAQAFASAQGLLGASETVNRAL
LEKMPALRAASTISVGYDNVEVDALTARKIVLMHTPTVLTETVADTVMALMLATARRVVD
VAERVKAGEWTESIGPAWFGVDVHHKTLGIVGMGRIGMALAQRAHFGFTMPVLYHARRRH
QEAEDRFNARYCDLDTLLQEADFVCVILPLTAETRHLFGATQFARMKSSAIFINAGRGPV
VDENALIAALQNGEIYAAGLDVFEQEPLSVDSPLLNMSNVVAVPHIGSATHETRYNMMAC
AVDNLIDALQGKIEKNCVNPQAAG
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaagccgtccatcattctctacaaaaccctgcctgatgatttgctacatcgcctggag
gcgcattttaccgtcacccaggtaccgaacctgcatccggaaacggtagcgcgacacgcg
caggcatttgccagcgcgcaaggccttctgggcgccagcgaaaccgttaaccgcgcgctg
ctggaaaaaatgccggcgctacgcgcggcgtcaaccatctcggtgggatacgataatgtc
gaggtggacgcccttactgcccgcaaaatagtcctgatgcacacgcctaccgttttgacg
gaaaccgttgccgatacggtgatggcattgatgctggccactgcccgccgcgtggtggac
gtcgcagaacgggttaaggcgggtgaatggacagaaagcattggcccggcgtggtttggc
gtcgatgtccatcacaaaacgctcggtatcgttgggatggggcgtatcgggatggcgctg
gcgcagcgagcgcactttgggtttaccatgccggttctctatcacgcccgtcggcggcat
caggaggcggaagaccggtttaacgcccgctactgcgatctggatacgttgttgcaggag
gctgattttgtctgcgtgatcctgccgctaacggcagaaacgcgacatctgtttggcgca
acacagtttgccagaatgaaatcgtccgccatttttattaatgccggacgcggcccggtg
gtcgatgaaaacgcgctgattgccgcgctgcaaaacggtgaaatatatgcggcaggtctg
gatgtctttgaacaggaaccgctatctgtggattcgcccctgctgaacatgtctaatgtc
gtcgcggtgccgcatattggctcggcaacgcatgagacgcgctacaacatgatggcctgt
gcggtggataatttgattgatgcgctgcagggaaaaatagagaagaactgcgtcaatccg
caagcggcgggataa

DBGET integrated database retrieval system