KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4415Help
Entry
SPC_4415          CDS       T00862                                 

Definition
(GenBank) hypothetical protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Glucosaminidase
Motif
Other DBs
NCBI-ProteinID: ACN48468
UniProt: C0Q5C1
Position
4523361..4523912
Genome map
AA seq 183 aa AA seqDB search
MATEVGVPAEALYSVSLAETSRKLPHGERPWPWTLNVAGKGYRYNSRQEAYDAMLSFMRR
YPLKRIDVGIAQVNLGWNGTYFSSYYEALDPYTNLRVAARILKSCYDNNPGSWIQAAGCY
HHPAGGKPARIYKSIVKRKLATLDLNAPVTYSELQIAQISPSQRHFSHYNRELQWVEPRE
SRQ
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
gtggcaactgaagtcggcgtacccgctgaagccctgtattcagtttctcttgcagaaaca
tcccgaaaactaccacatggagagcgaccgtggccgtggacactcaatgttgccgggaaa
gggtatcggtataactcccgccaggaagcgtatgacgcaatgttgtcgttcatgcgtcgc
tatccgttaaagcggattgatgttgggatcgcgcaggttaacctgggctggaatggaact
tatttcagcagttactacgaagcgctggatccatataccaaccttcgggttgccgcccgt
attcttaaatcctgttatgacaacaatccgggaagctggatacaggccgcggggtgttat
caccatcctgcaggtggaaaaccagcacgaatctataagtccatcgtgaaacgcaagctg
gcaacactggatttaaacgcgccagtaacgtactccgaacttcagatcgcacagatatcg
ccatcacagcgccatttctcacactacaaccgtgaattgcaatgggttgaacccagggag
tcccgtcagtga

DBGET integrated database retrieval system