KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4416Help
Entry
SPC_4416          CDS       T00862                                 

Definition
(GenBank) hypothetical protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2859
Motif
Other DBs
NCBI-ProteinID: ACN48469
UniProt: C0Q5C2
Position
4523948..4524448
Genome map
AA seq 166 aa AA seqDB search
MVSILLTTSSMAALNVIADLGGEPTAPLFDAINNKNNEFTPPRSLNATGASVTAAPADVS
DMLPVTTPEMRAGKVEARELNLNGMTPVFLVGDDSLSREWLTMRRDELKRLHATGLVVNV
SDKDALSELQQIIPDVILLPASASEIARRLHLNHYPVLITATGLAQ
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atggtcagtattttgctgacaacatcatcgatggcagcactcaatgtgattgctgatctt
ggcggagaaccaacagcgccgctttttgatgccatcaataataagaacaacgagttcact
ccgccgaggtcactgaacgccacgggcgcgtctgtaaccgcagcccctgcggatgtaagt
gatatgctgcccgtaaccacaccggaaatgcgtgcagggaaagtggaagcccgtgagtta
aatctgaacgggatgacaccggtctttcttgttggggatgattcgctttcacgcgagtgg
ttgacgatgcggcgtgatgagcttaagcgacttcatgctacaggtctggtggtgaatgtc
agcgataaggacgcgttgtcggaacttcagcaaatcatacctgatgtcattctgctaccg
gcatcggcaagcgaaatagcgcgtcgtttgcatctcaaccactacccggtgttgattacc
gccaccggtctggcccagtag

DBGET integrated database retrieval system