KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4424
Entry
SPC_4424          CDS       T00862                                 

Definition
(GenBank) possible exported protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: ACN48477
UniProt: C0Q5D0
Position
4529478..4530047
AA seq 189 aa
MILVITGWMRAPSDLTIHNPPDLRSGSTRKWWEVPPSTVYSFAFYIFQQINAWPKDGEKD
YPMKIAQLSPYLTPSCQDFLNKDAELRSQKGELLDRVRVVYEIPKRGYKPESVIIESDDS
WEVSLDLVVDEYYHTEPVKRALARYPLHIVRWEGDPERNAFGLALDCYKGVPQRLEAAVV
PEPEKKGMF
NT seq 570 nt   +upstreamnt  +downstreamnt
ttgattctggttattacaggatggatgcgggcgcccagtgacctgacaatacataacccg
ccagatttacgcagcgggagtacgcgtaaatggtgggaggtccctccgagtacggtctac
agctttgccttttatatttttcagcaaattaatgcctggccgaaggacggagaaaaagac
tatccgatgaaaattgcccagttgagtccttatcttacgccatcatgccaggattttttg
aataaggatgctgagctacggagtcaaaaaggtgagttgcttgatcgcgttcgcgtcgtt
tatgagatccccaaacgtggttacaaacctgaaagtgtcatcattgagagcgatgacagt
tgggaggtcagtctggatttggtagtcgatgaatactatcacacagaacctgtaaaacgg
gcactggccagataccccctgcatattgtccgctgggaaggtgatccggagcgcaatgct
tttggtctggcgcttgattgctataaaggcgtcccacaacgacttgaagctgcagtggtc
cctgagccagagaaaaaggggatgttttaa

DBGET integrated database retrieval system