KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4425
Entry
SPC_4425          CDS       T00862                                 

Definition
(GenBank) hypothetical protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
SSDB
Motif
Pfam: DUF3438
Other DBs
NCBI-ProteinID: ACN48478
UniProt: C0Q5D1
Position
4530047..4530946
AA seq 299 aa
MAMFKVLNFKCKWWPIILLLWFSSAQAVELMKWERIPLLIPLSVNHERIVFVDRNVRVGF
PAMLKGKLRVQSSGGTVYLQASEPFEQTRLQLQDVESGEIILLDIAAKNDNKALEPVRLV
YSGEVLSVSEKGMETGSSLPVASLDTEDKNQTVRKTPVYSAPLPVVLTRYAAQSLYAPLR
TVEAVPGIHPVNLRLPSRLTTLYPSENVVVSPIGAWGIQELNVVALKIRNRSSSKVILDA
RTLSGSFVSATFQHRWLGAAGTPEDTTTLYLVIRGRPENAFIAEPAVLPAVKKGEQHAN
NT seq 900 nt   +upstreamnt  +downstreamnt
atggcgatgtttaaagtccttaattttaagtgtaaatggtggccgataattctcctttta
tggttttcatcagcacaggctgtggagctgatgaaatgggaacggatccctctgcttatt
ccactttctgttaaccatgagcgaattgtctttgtcgaccgcaacgttcgtgtaggtttt
ccggcaatgctcaaaggtaaactgagggttcaaagcagcggtggtacggtttatttacag
gccagcgaaccttttgaacagacccgacttcaactgcaggatgttgaatcgggcgagatt
atattactggatattgctgccaaaaatgacaataaggcgcttgagcctgttcgcctggtt
tattcgggagaagtgttatcggtgagcgaaaaaggaatggaaacgggttcttcgttgcca
gtcgcctctttggatacagaagataaaaatcagactgtcagaaaaacgccggtgtacagt
gctccattgccagtggtgttgactcgttatgctgcacaaagtctgtatgcccctctacgc
actgttgaagctgtacccggaattcatccggtaaatttacgccttccctcgagactcaca
actttatatccgtctgagaatgtagttgtttcgccaataggggcatggggtattcaggaa
ctgaatgttgttgcactgaaaatccggaatcgttcttcctccaaagtgatacttgatgcc
cggactttatcaggatcgtttgtcagtgcgactttccagcatcgttggcttggggcggct
ggtacgcctgaagatacaacaactctttatcttgtgatcagagggcgccctgagaatgcc
tttattgctgaacctgcagtattgccggcagtaaaaaaaggggaacagcatgcaaattaa

DBGET integrated database retrieval system