KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4428Help
Entry
SPC_4428          CDS       T00862                                 

Definition
(GenBank) hypothetical protein
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ACN48481
UniProt: C0Q5D4
Position
4535842..4536228
Genome map
AA seq 128 aa AA seqDB search
MSLLKHEQWLILGEDESHRIPPDALLGLPPQGKAWIRKEHDEDMSRLTSHIQGALGNTYR
GVCHPQRIGHRACLAIHLENLRGKKLDILITVSGKTALPAEESYVNPRWYIDVADAADAL
YLALWLIR
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgttaaagcatgagcaatggttaattctcggtgaagatgaatcgcatcgtatt
ccgcctgatgcgctgctgggtttgcctccgcagggtaaagcgtggatccgcaaggaacat
gatgaggatatgagtcgtctgacttctcatattcagggagctcttggcaatacttatcgt
ggggtttgtcatccacagcgtatcgggcatcgtgcctgcctggcaatccatcttgagaat
ttacgcggaaaaaagctggatatattaattacggtaagcggaaagacagcattacctgcg
gaggaaagttacgttaatccccgatggtacatcgatgttgccgatgccgcagatgccctt
tatctggcgctgtggcttatcaggtag

DBGET integrated database retrieval system