KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4592Help
Entry
SPC_4592          CDS       T00862                                 

Gene name
pyrB
Definition
(GenBank) aspartate carbamoyltransferase catalytic subunit
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00240  Pyrimidine metabolism
sei00250  Alanine, aspartate and glutamate metabolism
sei01100  Metabolic pathways
Module
sei_M00051  Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:sei00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SPC_4592 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPC_4592 (pyrB)
Enzymes [BR:sei01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SPC_4592 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ACN48641
UniProt: C0Q7B8
Position
complement(4695238..4696173)
Genome map
AA seq 311 aa AA seqDB search
MANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLKHKVIASCFFEASTRTRLSF
ETSMHRLGASVVGFSDSANTSLGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFS
GQVPVLNAGDGSNQHPTQTLLDLFTIQETQGRLDNLHIAMVGDLKYGRTVHSLTQALAKF
SGNRFYFIAPDALAMPQYILDMLDEKGMAWSPHGSIEEVMADVDILYMTRVQKERLDPSE
YANVKAQFVLRASDLNGARENMKVLHPLPRIDEITTDVDKTPHAWYFQQAGNGIFARQAL
LALVLNSELSL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggctaacccgctatatcaaaaacatatcatttccataaacgacctcagccgcgacgat
cttaatctggtactggcgacggcggcgaaattaaaagccaacccgcagccggagcttttg
aaacataaagtgatcgccagctgctttttcgaagcctccacgcgtacccgcctgtcgttt
gaaacttcaatgcatcgcctgggcgccagcgtagtgggcttctccgacagcgccaacacg
tcgctggggaaaaaaggagaaacgttagccgacacgatctcagtgattagcacttacgtg
gacgcgattgtgatgcgccatccgcaagaaggcgcggcacgtctggcgacggagttttcc
ggtcaggtgccggtgctcaatgcgggcgacggttcgaatcagcatccgacgcaaaccctg
ttggatctgttcaccatccaggaaacgcagggccgtctggataacctgcatatcgcgatg
gtcggcgatctgaaatatggccgcaccgtgcattcgctaacccaggcgctggcgaaattt
agcggcaaccgtttttattttatcgcgccggacgcgctggcgatgccgcagtacattctg
gatatgctggatgaaaaagggatggcctggagcccgcatggttctattgaagaggtcatg
gccgacgtcgacatcctctatatgactcgcgtacagaaagagcgtctcgacccgtcggag
tacgccaatgtgaaggcgcagtttgttctgcgcgccagcgacctgaacggcgcgcgtgaa
aatatgaaagtgctgcacccgctgccgcggattgatgaaatcaccacggatgtggataaa
acgccacacgcctggtacttccaacaggcgggcaacggtattttcgctcgccaggcgtta
ctggcgttagtactgaatagcgaactgagtctgtaa

DBGET integrated database retrieval system