KEGG   Salmonella enterica subsp. enterica serovar Paratyphi C: SPC_4713Help
Entry
SPC_4713          CDS       T00862                                 

Gene name
nadR
Definition
(GenBank) nicotinamide-nucleotide adenylyltransferase
  KO
K06211  HTH-type transcriptional regulator, transcriptional repressor of NAD biosynthesis genes [EC:2.7.7.1 2.7.1.22]
Organism
sei  Salmonella enterica subsp. enterica serovar Paratyphi C
Pathway
sei00760  Nicotinate and nicotinamide metabolism
sei01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sei00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    SPC_4713 (nadR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sei03000]
    SPC_4713 (nadR)
Enzymes [BR:sei01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.22  ribosylnicotinamide kinase
     SPC_4713 (nadR)
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     SPC_4713 (nadR)
Transcription factors [BR:sei03000]
 Prokaryotic Type
  Helix-turn-helix
   Other families
    SPC_4713 (nadR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_28 HTH_3 HTH_31 HTH_19 CTP_transf_like Citrate_ly_lig HTH_26 MMR_HSR1 HTH_37 ABC_tran AAA_29 FAD_syn Dynamin_N
Motif
Other DBs
NCBI-ProteinID: ACN48756
UniProt: C0Q8F0
Position
4811354..4812691
Genome map
AA seq 445 aa AA seqDB search
MAMQCVLSGLRIDVVGLISEAPSGSVMRFFQQEALVSSFDYLKTAIKQQGCTLQQVADAS
GMTKGYLSQLLNAKIKSPSAQKLEALHRFLGLEFPRRQKNIGVVFGKFYPLHTGHIYLIQ
RACSQVDELHIIMGYDDTRDRGLFEDSAMSQQPTVSDRLRWLLQTFKYQKNIRIHAFNEE
GMEPYPHGWDVWSNGIKAFMAEKGIQPSWIYTSEEADAPQYLEHLGIETVLVDPERTFMN
ISGAQIRENPFRYWEYIPTEVKPFFVRTVAILGGESSGKSTLVNKLANIFNTTSAWEYGR
DYVFSHLGGDEMALQYSDYDKIALGHAQYIDFAVKYANKVAFIDTDFVTTQAFCKKYEGR
EHPFVQALIDEYRFDLVILLENNTPWIADGLRSLGSSVDRKAFQNLLVEMLKENNIEFVH
VKEADYDGRFLRCVELVKEMMGEQG
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgcaatgcgtcttatccggcctacggattgatgttgtaggcctgataagcgaa
gcgccgtcaggcagtgttatgcgatttttccagcaggaggctcttgtgtcatcgttcgac
tatctcaaaaccgcgattaagcagcaaggttgcactctgcaacaggtggctgacgccagc
ggtatgaccaaggggtatctgagtcagttacttaacgccaaaatcaaaagccccagcgcg
caaaaactggaggcgctacaccgttttctcgggctggagtttccccgccgacagaaaaac
attggcgtggtgttcggtaaattttatccattgcataccggacacatctacttgatccag
cgcgcctgtagccaggtggatgagttgcatatcattatgggatatgacgatacgcgcgac
cgcgggctgtttgaggatagcgccatgtcgcagcagcccaccgtgtcggatcgcctgcgc
tggttgctgcaaaccttcaaataccaaaaaaatattcgcatccacgcctttaatgaagag
gggatggagccttatccgcatggctgggacgtctggagcaacggcattaaagcgtttatg
gcagagaagggaatacagccgagctggatctacacttccgaagaggctgatgcgccgcag
taccttgagcatttagggattgagacggtgctggtcgatcctgaacgcacgtttatgaat
atcagcggggcgcaaatccgcgaaaatccgtttcgttactgggaatatattcctaccgaa
gtgaagccgtttttcgtgcgtaccgtcgcgattctgggcggggaatcaagcggcaagtct
acgctggtcaataagctcgccaatatttttaataccaccagcgcctgggaatatggccgc
gactatgtcttttcgcatctgggcggcgatgagatggcgttacagtattccgactacgat
aaaatcgcgctgggtcatgcgcaatatattgatttcgcagtaaaatatgcgaataaagtg
gcgtttatcgataccgatttcgtcaccacccaggcattttgcaaaaaatacgaagggcgc
gagcatccctttgtccaggctctgatcgacgagtatcgcttcgacctggtgattttgctg
gagaataatacgccttggatagctgacggactgcgaagcctgggcagttcagtggatcgc
aaagcgttccagaacctgctggtcgagatgctgaaagaaaacaacattgagttcgttcac
gttaaagaggctgattacgatggccgctttttgcgctgtgtggaactggtgaaagagatg
atgggcgagcagggataa

DBGET integrated database retrieval system