KEGG   Salmonella enterica subsp. enterica serovar Typhimurium UK-1: STMUK_0004Help
Entry
STMUK_0004        CDS       T01743                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
sej  Salmonella enterica subsp. enterica serovar Typhimurium UK-1
Pathway
sej00260  Glycine, serine and threonine metabolism
sej00750  Vitamin B6 metabolism
sej01100  Metabolic pathways
sej01110  Biosynthesis of secondary metabolites
sej01120  Microbial metabolism in diverse environments
sej01230  Biosynthesis of amino acids
Module
sej_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sej00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    STMUK_0004 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    STMUK_0004 (thrC)
Enzymes [BR:sej01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     STMUK_0004 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AEF05938
Position
3735..5021
Genome map
AA seq 428 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDEMLNQDFVSRSAKILS
AFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTH
ISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGKWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRA
LRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAAL
RKLMMTRQ
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaaactctataatctgaaagaccataatgagcaggtcagctttgcgcaggccgtcacg
caaggactgggcaaacagcagggacttttttttccgcacgatctgccggagtttagcctg
acggaaattgatgagatgctcaaccaggactttgtcagccgtagcgcaaagatcctctcg
gcatttattggcgatgaaataccgcagcaaattctggaagagcgcgtccgcgcggcgttt
gcgttcccggcaccggtagcgcaggtagaaagcgatgtcggctgcctggagctgttccat
ggtccgacgctggcctttaaagacttcggcgggcgttttatggcgcaaatgctgacgcat
atcagcggcgacaaaccggtgacgattctgactgcaacgtcaggcgataccggcgcggcg
gtggctcacgcgttctatggcctggaaaatgtgcgggtcgtcattctctacccgcgcggt
aagatcagtccgttgcaggaaaaactgttctgtacgctgggcggcaacattgaaaccgtg
gcgatcgacggcgatttcgacgcgtgccaggcgctggtgaaacaggcatttgatgacgaa
gaactgaaaacggcgctggggctgaattcggctaattcgattaatatcagccgcctgttg
gcgcaaatttgctactactttgaagccgtggcgcaactgccgcagggggcgcgtaaccaa
ctggtgatctccgtccccagcggcaactttggcgatttgacggcagggctgctggcgaag
tcgttaggcctaccggtgaaacgttttatcgccgccaccaacgtcaacgacacggtgccg
cgttttctgcatgacggaaagtgggcgccgaaagcgacgcaggcgaccctgtcgaatgcg
atggatgtcagccagccgaataactggccgcgcgtggaggagctattccgccgtaaaatc
tggcgcctgactgagctgggctatgcggcggtggatgatactacgacacagcagacgatg
cgcgagctgaaagcgaaaggttatatctcggaacctcatgcggcggtagcgtatcgggca
ttacgcgaccagttaaaccctggcgagtatggcttgtttctcggaacggcgcatccggcg
aagtttaaagagagcgtggagtccattctgggagaaacgctggccttgcctgaagcgctc
gccgaacgcgccgacctgccgctgctttcacatcatctgcctgcggattttgccgccctg
cgtaagctgatgatgacccgccaataa

DBGET integrated database retrieval system